Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	63897
Gene name	HEAT repeat containing 6
Gene symbol	HEATR6
Synonyms (NCBI Gene)	ABC1
Chromosome	17
Chromosome location	17q23.1

102

Show/Hide all (102)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016557	hsa-miR-193b-3p	Proteomics	21512034
MIRT049537	hsa-miR-92a-3p	CLASH	23622248
MIRT039759	hsa-miR-615-3p	CLASH	23622248
MIRT1043287	hsa-miR-1237	CLIP-seq
MIRT1043288	hsa-miR-1248	CLIP-seq
MIRT1043289	hsa-miR-1323	CLIP-seq
MIRT1043290	hsa-miR-330-3p	CLIP-seq
MIRT1043291	hsa-miR-338-5p	CLIP-seq
MIRT1043292	hsa-miR-365	CLIP-seq
MIRT1043293	hsa-miR-3672	CLIP-seq
MIRT1043294	hsa-miR-4251	CLIP-seq
MIRT1043295	hsa-miR-4290	CLIP-seq
MIRT1043296	hsa-miR-4303	CLIP-seq
MIRT1043297	hsa-miR-4329	CLIP-seq
MIRT1043298	hsa-miR-4666-3p	CLIP-seq
MIRT1043299	hsa-miR-4731-3p	CLIP-seq
MIRT1043300	hsa-miR-4735-5p	CLIP-seq
MIRT1043301	hsa-miR-4742-3p	CLIP-seq
MIRT1043302	hsa-miR-4762-3p	CLIP-seq
MIRT1043303	hsa-miR-4801	CLIP-seq
MIRT1043304	hsa-miR-500a	CLIP-seq
MIRT1043305	hsa-miR-520d-5p	CLIP-seq
MIRT1043306	hsa-miR-524-5p	CLIP-seq
MIRT1043307	hsa-miR-548o	CLIP-seq
MIRT1043308	hsa-miR-556-3p	CLIP-seq
MIRT1043309	hsa-miR-576-5p	CLIP-seq
MIRT2009249	hsa-miR-1225-3p	CLIP-seq
MIRT2009250	hsa-miR-1233	CLIP-seq
MIRT2009251	hsa-miR-1273g	CLIP-seq
MIRT2009252	hsa-miR-1289	CLIP-seq
MIRT2009253	hsa-miR-1825	CLIP-seq
MIRT2009254	hsa-miR-3145-5p	CLIP-seq
MIRT2009255	hsa-miR-3198	CLIP-seq
MIRT2009256	hsa-miR-4294	CLIP-seq
MIRT2009257	hsa-miR-4309	CLIP-seq
MIRT2009258	hsa-miR-4435	CLIP-seq
MIRT2009259	hsa-miR-4687-5p	CLIP-seq
MIRT2009260	hsa-miR-4732-3p	CLIP-seq
MIRT2009261	hsa-miR-4802-5p	CLIP-seq
MIRT2009262	hsa-miR-483-3p	CLIP-seq
MIRT2009263	hsa-miR-563	CLIP-seq
MIRT2009264	hsa-miR-591	CLIP-seq
MIRT2009265	hsa-miR-668	CLIP-seq
MIRT2009266	hsa-miR-876-3p	CLIP-seq
MIRT2241682	hsa-miR-1913	CLIP-seq
MIRT2241683	hsa-miR-3121-3p	CLIP-seq
MIRT2241684	hsa-miR-324-3p	CLIP-seq
MIRT2241685	hsa-miR-3606	CLIP-seq
MIRT2241686	hsa-miR-4426	CLIP-seq
MIRT2241687	hsa-miR-4445	CLIP-seq
MIRT2241688	hsa-miR-4647	CLIP-seq
MIRT2241689	hsa-miR-4662b	CLIP-seq
MIRT2241690	hsa-miR-4727-5p	CLIP-seq
MIRT2241691	hsa-miR-4799-5p	CLIP-seq
MIRT1043305	hsa-miR-520d-5p	CLIP-seq
MIRT1043306	hsa-miR-524-5p	CLIP-seq
MIRT2241692	hsa-miR-544	CLIP-seq
MIRT1043308	hsa-miR-556-3p	CLIP-seq
MIRT2241693	hsa-miR-887	CLIP-seq
MIRT2009249	hsa-miR-1225-3p	CLIP-seq
MIRT2009250	hsa-miR-1233	CLIP-seq
MIRT2545285	hsa-miR-1245b-3p	CLIP-seq
MIRT2009251	hsa-miR-1273g	CLIP-seq
MIRT2009252	hsa-miR-1289	CLIP-seq
MIRT2009253	hsa-miR-1825	CLIP-seq
MIRT2009254	hsa-miR-3145-5p	CLIP-seq
MIRT2009255	hsa-miR-3198	CLIP-seq
MIRT2545286	hsa-miR-3690	CLIP-seq
MIRT2545287	hsa-miR-4254	CLIP-seq
MIRT2009256	hsa-miR-4294	CLIP-seq
MIRT2009257	hsa-miR-4309	CLIP-seq
MIRT2009258	hsa-miR-4435	CLIP-seq
MIRT2545288	hsa-miR-4638-5p	CLIP-seq
MIRT2009259	hsa-miR-4687-5p	CLIP-seq
MIRT2009260	hsa-miR-4732-3p	CLIP-seq
MIRT2009261	hsa-miR-4802-5p	CLIP-seq
MIRT2009262	hsa-miR-483-3p	CLIP-seq
MIRT2009263	hsa-miR-563	CLIP-seq
MIRT2009264	hsa-miR-591	CLIP-seq
MIRT2009265	hsa-miR-668	CLIP-seq
MIRT2009266	hsa-miR-876-3p	CLIP-seq
MIRT2009249	hsa-miR-1225-3p	CLIP-seq
MIRT2009250	hsa-miR-1233	CLIP-seq
MIRT2545285	hsa-miR-1245b-3p	CLIP-seq
MIRT2009251	hsa-miR-1273g	CLIP-seq
MIRT2009252	hsa-miR-1289	CLIP-seq
MIRT2009253	hsa-miR-1825	CLIP-seq
MIRT2009254	hsa-miR-3145-5p	CLIP-seq
MIRT2009255	hsa-miR-3198	CLIP-seq
MIRT2545286	hsa-miR-3690	CLIP-seq
MIRT2545287	hsa-miR-4254	CLIP-seq
MIRT2009256	hsa-miR-4294	CLIP-seq
MIRT2009257	hsa-miR-4309	CLIP-seq
MIRT2009258	hsa-miR-4435	CLIP-seq
MIRT2545288	hsa-miR-4638-5p	CLIP-seq
MIRT2009260	hsa-miR-4732-3p	CLIP-seq
MIRT2009261	hsa-miR-4802-5p	CLIP-seq
MIRT2009262	hsa-miR-483-3p	CLIP-seq
MIRT2009263	hsa-miR-563	CLIP-seq
MIRT2009264	hsa-miR-591	CLIP-seq
MIRT2009265	hsa-miR-668	CLIP-seq
MIRT2009266	hsa-miR-876-3p	CLIP-seq

Show/Hide all (1)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22681889

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q6AI08

Protein name

HEAT repeat-containing protein 6 (Amplified in breast cancer protein 1)

Protein function

Amplification-dependent oncogene.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13251	DUF4042	418 → 599	Domain of unknown function (DUF4042)	Family

Tissue specificity

TISSUE SPECIFICITY: Amplified in breast cancer cell lines MCF-7 and BT-474. {ECO:0000269|PubMed:11431322}.

Sequence

MAAVQVVGSWPSVQPREAPREAIPERGNGFRLLSARLCALRPDDSSSARTEIHLLFDQLI
SENYSEGSGVAPEDVSALLVQACRLVPLNQNHLVSKVSQLIHHLLNRLQVIVDEQHLDFL
LAYTISAIHQCSSWTHREILQALAALVYCNGSKCQKYLPELLGNTGLLMKLSDLAQSDPE
VRRAAVHCMANLCLSVPGQPYLEEPYQNVCFQAFLTILQSPKSSDMDDITFCMLLQNALK
GIQSLLNGGRMKLTQTDELGALLAVLKKFMFHGLPGLNIEMPTVLYPTPLPQYDGRTPIK
PQQSESSASRPTLNKKKKSKVKPKKIQQGEEEEKESSGEIEAAPVTGTGRVNLHEGNTWC
PSSLGVQSLPLDGSGAAEKDGVSSSFSSSSWKRVSSSESDFSDAEGGMQSKMRSYQAKVR
QGALVCFLSTIKSIEKKVLYGYWSAFIPDTPELGSPQSVSLMTLTLKDPSPKTRACALQV
LSAILEGSKQFLSVAEDTSDHRRAFTPFSVMIACSIRELHRCLLLALVAESSSQTVTQII
KCLANLVSNAPYDRLKLSLLTKVWNQIKPYIRHKDVNVRVSSLTLLGAIVSTHAPLPEVQ
LLLQQPCSSGLGNSNSATPHLSPPDWWKKAPAGPSLEETSVSSPKGSSEPCWLIRLCISI
VVLPKEDSCSGSDAGSAAGSTYEPSPMRLEALQVLTLLARGYFSMTQAYLMELGEVICKC
MGEADPSIQLHGAKLLEELGTGLIQQYKPDSTAAPDQRAPVFLVVMFWTMMLNGPLPRAL
QNSEHPTLQASACDALSSILPEAFSNLPNDRQMLCITVLLGLNDSKNRLVKAATSRALGV
YVLFPCLRQDVIFVADAANAILMSLEDKSLNVRAKAAWSLGNLTDTLIVNMETPDPSFQE
EFSGLLLLKMLRSAIEASKDKDKVKSNAVRALGNLLHFLQPSHIEKPTFAEIIEESIQAL
ISTVLTEAAMKVRWNACYAMGNVFKNPALPLGTAPWTSQAYNALTSVVTSCKNFKVRIRS
AAALSVPGKREQYGSVDQYARIWNALVTALQKSEDTIDFLEFKYCVSLRTQICQALIHLL
SLASASDLPCMKETLELSGNMVQSYILQFLKSGAEGDDTGAPHSPQERDQMVRMALKHMG
SIQAPTGDTARRAIMGFLEEILAVCFDSSGSQGALPGLTNQ

Sequence length

1181

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (31)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30103827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11221879, 11678305, 11768608, 12964942, 15900600, 18644862, 18827493, 19418218, 23670096, 23762395, 27665502, 30953646, 31045512, 31437536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11502741, 12964942, 23762395, 24788909, 30796653, 31045512, 31635050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27105488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	30796653	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29271993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	10431237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25263446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	11257260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	11257260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	11257260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	16980945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	15448000, 16951183, 17671194, 18765637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial HDL deficiency	Glucocorticoid Deficiency	BEFREE	10431236, 10533863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	16926624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoalphalipoproteinemia, Familial	Hypoalphalipoproteinemia	BEFREE	10431236, 10533863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	20064830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20064830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11221879, 11678305, 11768608, 12964942, 15900600, 18644862, 18827493, 19418218, 19491275, 23322234, 23670096, 23762395, 27665502, 30953646, 31045512, 31437536 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29271993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20064830, 23559371, 25263446, 31602272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11221879, 31437536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17133272, 20064830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	23851504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	28766132		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29271993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29271993	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	30352687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	31045512	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tangier Disease	Tangier Disease	BEFREE	10431236, 10431237, 10431238, 10525055, 10533863, 10535983, 10655069, 10812922, 11257260, 12615648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31437536		★★★★★ ★☆☆☆☆ Found in Text Mining only

HEATR6 (HEAT repeat containing 6)