Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6387
Gene name	C-X-C motif chemokine ligand 12
Gene symbol	CXCL12
Synonyms (NCBI Gene)	IRHPBSFSCYB12SDF1TLSFTPAR1
Chromosome	10
Chromosome location	10q11.21
Summary	This antimicrobial gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse ce

818

Show/Hide all (818)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004980	hsa-miR-31-5p	Luciferase reporter assayqRT-PCR	19524507
MIRT001776	hsa-miR-23a-3p	Luciferase reporter assay	14697198
MIRT007380	hsa-miR-126-5p	Luciferase reporter assay	23396050
MIRT007381	hsa-miR-126-3p	Luciferase reporter assay	23396050
MIRT001776	hsa-miR-23a-3p	Reporter assay;Other	14697198
MIRT004980	hsa-miR-31-5p	qRT-PCR	24855107
MIRT004980	hsa-miR-31-5p	qRT-PCR	24855107
MIRT438058	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRMicroarray	23963696
MIRT438058	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRMicroarray	23963696
MIRT438058	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRMicroarray	23963696
MIRT438058	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRMicroarray	23963696
MIRT610965	hsa-miR-8485	HITS-CLIP	23824327
MIRT610964	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610963	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610962	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT610961	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT610960	hsa-miR-6072	HITS-CLIP	23824327
MIRT610959	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT610958	hsa-miR-7152-3p	HITS-CLIP	23824327
MIRT610965	hsa-miR-8485	HITS-CLIP	23824327
MIRT610964	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610963	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610962	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT610961	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT610960	hsa-miR-6072	HITS-CLIP	23824327
MIRT610959	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT610958	hsa-miR-7152-3p	HITS-CLIP	23824327
MIRT731986	hsa-miR-221-3p	Luciferase reporter assayqRT-PCRWestern blot	28236026
MIRT731986	hsa-miR-221-3p	Luciferase reporter assayqRT-PCRWestern blot	28236026
MIRT736182	hsa-miR-423-5p	RNA-seqqRT-PCR	31920480
MIRT736521	hsa-miR-4459	qRT-PCR	34288395
MIRT736522	hsa-miR-1225-5p	qRT-PCR	34288395
MIRT610965	hsa-miR-8485	HITS-CLIP	23824327
MIRT610964	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610963	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610962	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT610961	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT610960	hsa-miR-6072	HITS-CLIP	23824327
MIRT610959	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT610958	hsa-miR-7152-3p	HITS-CLIP	23824327
MIRT610965	hsa-miR-8485	HITS-CLIP	23824327
MIRT610964	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610963	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610962	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT610961	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT610960	hsa-miR-6072	HITS-CLIP	23824327
MIRT610959	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT610958	hsa-miR-7152-3p	HITS-CLIP	23824327
MIRT007381	hsa-miR-126-3p	qRT-PCRELISA	37699959
MIRT917670	hsa-miR-101	CLIP-seq
MIRT917671	hsa-miR-105	CLIP-seq
MIRT917672	hsa-miR-1200	CLIP-seq
MIRT917673	hsa-miR-1206	CLIP-seq
MIRT917674	hsa-miR-124	CLIP-seq
MIRT917675	hsa-miR-1246	CLIP-seq
MIRT917676	hsa-miR-1255a	CLIP-seq
MIRT917677	hsa-miR-1255b	CLIP-seq
MIRT917678	hsa-miR-1265	CLIP-seq
MIRT917679	hsa-miR-1266	CLIP-seq
MIRT917680	hsa-miR-1275	CLIP-seq
MIRT917681	hsa-miR-128	CLIP-seq
MIRT917682	hsa-miR-1285	CLIP-seq
MIRT917683	hsa-miR-129-3p	CLIP-seq
MIRT917684	hsa-miR-1294	CLIP-seq
MIRT917685	hsa-miR-1303	CLIP-seq
MIRT917686	hsa-miR-133a	CLIP-seq
MIRT917687	hsa-miR-133b	CLIP-seq
MIRT917688	hsa-miR-141	CLIP-seq
MIRT917689	hsa-miR-144	CLIP-seq
MIRT917690	hsa-miR-146b-3p	CLIP-seq
MIRT917691	hsa-miR-148a	CLIP-seq
MIRT917692	hsa-miR-148b	CLIP-seq
MIRT917693	hsa-miR-152	CLIP-seq
MIRT917694	hsa-miR-1827	CLIP-seq
MIRT917695	hsa-miR-183	CLIP-seq
MIRT917696	hsa-miR-1911	CLIP-seq
MIRT917697	hsa-miR-1914	CLIP-seq
MIRT917698	hsa-miR-1976	CLIP-seq
MIRT917699	hsa-miR-19a	CLIP-seq
MIRT917700	hsa-miR-19b	CLIP-seq
MIRT917701	hsa-miR-200a	CLIP-seq
MIRT917702	hsa-miR-203	CLIP-seq
MIRT917703	hsa-miR-204	CLIP-seq
MIRT917704	hsa-miR-2052	CLIP-seq
MIRT917705	hsa-miR-211	CLIP-seq
MIRT917706	hsa-miR-2117	CLIP-seq
MIRT917707	hsa-miR-216a	CLIP-seq
MIRT917708	hsa-miR-216b	CLIP-seq
MIRT917709	hsa-miR-219-2-3p	CLIP-seq
MIRT917710	hsa-miR-219-5p	CLIP-seq
MIRT917711	hsa-miR-221	CLIP-seq
MIRT917712	hsa-miR-222	CLIP-seq
MIRT917713	hsa-miR-23a	CLIP-seq
MIRT917714	hsa-miR-23b	CLIP-seq
MIRT917715	hsa-miR-23c	CLIP-seq
MIRT917716	hsa-miR-28-5p	CLIP-seq
MIRT917717	hsa-miR-29a	CLIP-seq
MIRT917718	hsa-miR-29b	CLIP-seq
MIRT917719	hsa-miR-29c	CLIP-seq
MIRT917720	hsa-miR-302a	CLIP-seq
MIRT917721	hsa-miR-302b	CLIP-seq
MIRT917722	hsa-miR-302c	CLIP-seq
MIRT917723	hsa-miR-302d	CLIP-seq
MIRT917724	hsa-miR-302e	CLIP-seq
MIRT917725	hsa-miR-3065-3p	CLIP-seq
MIRT917726	hsa-miR-3074-5p	CLIP-seq
MIRT917727	hsa-miR-3123	CLIP-seq
MIRT917728	hsa-miR-3125	CLIP-seq
MIRT917729	hsa-miR-3126-3p	CLIP-seq
MIRT917730	hsa-miR-3126-5p	CLIP-seq
MIRT917731	hsa-miR-3137	CLIP-seq
MIRT917732	hsa-miR-3139	CLIP-seq
MIRT917733	hsa-miR-3155	CLIP-seq
MIRT917734	hsa-miR-3155b	CLIP-seq
MIRT917735	hsa-miR-3157-5p	CLIP-seq
MIRT917736	hsa-miR-3160-3p	CLIP-seq
MIRT917737	hsa-miR-3168	CLIP-seq
MIRT917738	hsa-miR-3173-5p	CLIP-seq
MIRT917739	hsa-miR-3176	CLIP-seq
MIRT917740	hsa-miR-3186-5p	CLIP-seq
MIRT917741	hsa-miR-3187-5p	CLIP-seq
MIRT917742	hsa-miR-3192	CLIP-seq
MIRT917743	hsa-miR-320e	CLIP-seq
MIRT917744	hsa-miR-338-5p	CLIP-seq
MIRT917745	hsa-miR-342-3p	CLIP-seq
MIRT917746	hsa-miR-3545-5p	CLIP-seq
MIRT917747	hsa-miR-3605-3p	CLIP-seq
MIRT917748	hsa-miR-3605-5p	CLIP-seq
MIRT917749	hsa-miR-3607-5p	CLIP-seq
MIRT917750	hsa-miR-3609	CLIP-seq
MIRT917751	hsa-miR-361-3p	CLIP-seq
MIRT917752	hsa-miR-361-5p	CLIP-seq
MIRT917753	hsa-miR-3617	CLIP-seq
MIRT917754	hsa-miR-3619-3p	CLIP-seq
MIRT917755	hsa-miR-3647-3p	CLIP-seq
MIRT917756	hsa-miR-3664-3p	CLIP-seq
MIRT917757	hsa-miR-3675-3p	CLIP-seq
MIRT917758	hsa-miR-3675-5p	CLIP-seq
MIRT917759	hsa-miR-3682-5p	CLIP-seq
MIRT917760	hsa-miR-3685	CLIP-seq
MIRT917761	hsa-miR-3686	CLIP-seq
MIRT917762	hsa-miR-3689d	CLIP-seq
MIRT917763	hsa-miR-3690	CLIP-seq
MIRT917764	hsa-miR-3691-3p	CLIP-seq
MIRT917765	hsa-miR-370	CLIP-seq
MIRT917766	hsa-miR-3714	CLIP-seq
MIRT917767	hsa-miR-371b-3p	CLIP-seq
MIRT917768	hsa-miR-372	CLIP-seq
MIRT917769	hsa-miR-373	CLIP-seq
MIRT917770	hsa-miR-374c	CLIP-seq
MIRT917771	hsa-miR-376c	CLIP-seq
MIRT917772	hsa-miR-383	CLIP-seq
MIRT917773	hsa-miR-3907	CLIP-seq
MIRT917774	hsa-miR-3910	CLIP-seq
MIRT917775	hsa-miR-3916	CLIP-seq
MIRT917776	hsa-miR-3919	CLIP-seq
MIRT917777	hsa-miR-3922-3p	CLIP-seq
MIRT917778	hsa-miR-3923	CLIP-seq
MIRT917779	hsa-miR-3925-3p	CLIP-seq
MIRT917780	hsa-miR-3925-5p	CLIP-seq
MIRT917781	hsa-miR-3927	CLIP-seq
MIRT917782	hsa-miR-3942-3p	CLIP-seq
MIRT917783	hsa-miR-3973	CLIP-seq
MIRT917784	hsa-miR-3978	CLIP-seq
MIRT917785	hsa-miR-411	CLIP-seq
MIRT917786	hsa-miR-423-3p	CLIP-seq
MIRT917787	hsa-miR-4254	CLIP-seq
MIRT917788	hsa-miR-4257	CLIP-seq
MIRT917789	hsa-miR-4270	CLIP-seq
MIRT917790	hsa-miR-4278	CLIP-seq
MIRT917791	hsa-miR-4279	CLIP-seq
MIRT917792	hsa-miR-4281	CLIP-seq
MIRT917793	hsa-miR-4290	CLIP-seq
MIRT917794	hsa-miR-4314	CLIP-seq
MIRT917795	hsa-miR-4316	CLIP-seq
MIRT917796	hsa-miR-4324	CLIP-seq
MIRT917797	hsa-miR-4327	CLIP-seq
MIRT917798	hsa-miR-4419a	CLIP-seq
MIRT917799	hsa-miR-4420	CLIP-seq
MIRT917800	hsa-miR-4422	CLIP-seq
MIRT917801	hsa-miR-4433	CLIP-seq
MIRT917802	hsa-miR-4441	CLIP-seq
MIRT917803	hsa-miR-4445	CLIP-seq
MIRT917804	hsa-miR-4446-5p	CLIP-seq
MIRT917805	hsa-miR-4449	CLIP-seq
MIRT917806	hsa-miR-4450	CLIP-seq
MIRT917807	hsa-miR-4451	CLIP-seq
MIRT917808	hsa-miR-4469	CLIP-seq
MIRT917809	hsa-miR-4470	CLIP-seq
MIRT917810	hsa-miR-4474-5p	CLIP-seq
MIRT917811	hsa-miR-4476	CLIP-seq
MIRT917812	hsa-miR-4484	CLIP-seq
MIRT917813	hsa-miR-4487	CLIP-seq
MIRT917814	hsa-miR-4488	CLIP-seq
MIRT917815	hsa-miR-4491	CLIP-seq
MIRT917816	hsa-miR-4496	CLIP-seq
MIRT917817	hsa-miR-4499	CLIP-seq
MIRT917818	hsa-miR-4510	CLIP-seq
MIRT917819	hsa-miR-4512	CLIP-seq
MIRT917820	hsa-miR-4518	CLIP-seq
MIRT917821	hsa-miR-4527	CLIP-seq
MIRT917822	hsa-miR-4533	CLIP-seq
MIRT917823	hsa-miR-4640-5p	CLIP-seq
MIRT917824	hsa-miR-4646-5p	CLIP-seq
MIRT917825	hsa-miR-4648	CLIP-seq
MIRT917826	hsa-miR-4654	CLIP-seq
MIRT917827	hsa-miR-4657	CLIP-seq
MIRT917828	hsa-miR-4665-5p	CLIP-seq
MIRT917829	hsa-miR-4666-5p	CLIP-seq
MIRT917830	hsa-miR-4687-5p	CLIP-seq
MIRT917831	hsa-miR-4690-3p	CLIP-seq
MIRT917832	hsa-miR-4693-3p	CLIP-seq
MIRT917833	hsa-miR-4697-5p	CLIP-seq
MIRT917834	hsa-miR-4699-3p	CLIP-seq
MIRT917835	hsa-miR-4708-5p	CLIP-seq
MIRT917836	hsa-miR-4711-5p	CLIP-seq
MIRT917837	hsa-miR-4716-3p	CLIP-seq
MIRT917838	hsa-miR-4726-5p	CLIP-seq
MIRT917839	hsa-miR-4731-3p	CLIP-seq
MIRT917840	hsa-miR-4732-5p	CLIP-seq
MIRT917841	hsa-miR-4733-3p	CLIP-seq
MIRT917842	hsa-miR-4736	CLIP-seq
MIRT917843	hsa-miR-4742-3p	CLIP-seq
MIRT917844	hsa-miR-4749-3p	CLIP-seq
MIRT917845	hsa-miR-4753-3p	CLIP-seq
MIRT917846	hsa-miR-4755-3p	CLIP-seq
MIRT917847	hsa-miR-4755-5p	CLIP-seq
MIRT917848	hsa-miR-4756-3p	CLIP-seq
MIRT917849	hsa-miR-4757-5p	CLIP-seq
MIRT917850	hsa-miR-4764-5p	CLIP-seq
MIRT917851	hsa-miR-4768-3p	CLIP-seq
MIRT917852	hsa-miR-4769-5p	CLIP-seq
MIRT917853	hsa-miR-4774-5p	CLIP-seq
MIRT917854	hsa-miR-4776-5p	CLIP-seq
MIRT917855	hsa-miR-4780	CLIP-seq
MIRT917856	hsa-miR-4782-3p	CLIP-seq
MIRT917857	hsa-miR-4797-5p	CLIP-seq
MIRT917858	hsa-miR-4801	CLIP-seq
MIRT917859	hsa-miR-484	CLIP-seq
MIRT917860	hsa-miR-486-3p	CLIP-seq
MIRT917861	hsa-miR-488	CLIP-seq
MIRT917862	hsa-miR-490-5p	CLIP-seq
MIRT917863	hsa-miR-491-3p	CLIP-seq
MIRT917864	hsa-miR-494	CLIP-seq
MIRT917865	hsa-miR-506	CLIP-seq
MIRT917866	hsa-miR-508-3p	CLIP-seq
MIRT917867	hsa-miR-5096	CLIP-seq
MIRT917868	hsa-miR-516b	CLIP-seq
MIRT917869	hsa-miR-519a	CLIP-seq
MIRT917870	hsa-miR-519b-3p	CLIP-seq
MIRT917871	hsa-miR-519c-3p	CLIP-seq
MIRT917872	hsa-miR-520a-3p	CLIP-seq
MIRT917873	hsa-miR-520b	CLIP-seq
MIRT917874	hsa-miR-520c-3p	CLIP-seq
MIRT917875	hsa-miR-520d-3p	CLIP-seq
MIRT917876	hsa-miR-520e	CLIP-seq
MIRT917877	hsa-miR-520g	CLIP-seq
MIRT917878	hsa-miR-520h	CLIP-seq
MIRT917879	hsa-miR-522	CLIP-seq
MIRT917880	hsa-miR-539	CLIP-seq
MIRT917881	hsa-miR-544b	CLIP-seq
MIRT917882	hsa-miR-548ah	CLIP-seq
MIRT917883	hsa-miR-548t	CLIP-seq
MIRT917884	hsa-miR-548v	CLIP-seq
MIRT917885	hsa-miR-576-3p	CLIP-seq
MIRT917886	hsa-miR-579	CLIP-seq
MIRT917887	hsa-miR-595	CLIP-seq
MIRT917888	hsa-miR-612	CLIP-seq
MIRT917889	hsa-miR-617	CLIP-seq
MIRT917890	hsa-miR-623	CLIP-seq
MIRT917891	hsa-miR-625	CLIP-seq
MIRT917892	hsa-miR-628-3p	CLIP-seq
MIRT917893	hsa-miR-636	CLIP-seq
MIRT917894	hsa-miR-641	CLIP-seq
MIRT917895	hsa-miR-642a	CLIP-seq
MIRT917896	hsa-miR-648	CLIP-seq
MIRT917897	hsa-miR-655	CLIP-seq
MIRT917898	hsa-miR-664	CLIP-seq
MIRT917899	hsa-miR-665	CLIP-seq
MIRT917900	hsa-miR-708	CLIP-seq
MIRT917901	hsa-miR-720	CLIP-seq
MIRT917902	hsa-miR-759	CLIP-seq
MIRT917903	hsa-miR-765	CLIP-seq
MIRT917904	hsa-miR-766	CLIP-seq
MIRT917905	hsa-miR-767-3p	CLIP-seq
MIRT917906	hsa-miR-874	CLIP-seq
MIRT917907	hsa-miR-877	CLIP-seq
MIRT917908	hsa-miR-885-3p	CLIP-seq
MIRT917909	hsa-miR-9	CLIP-seq
MIRT917910	hsa-miR-1179	CLIP-seq
MIRT917911	hsa-miR-130a	CLIP-seq
MIRT917912	hsa-miR-130b	CLIP-seq
MIRT917713	hsa-miR-23a	CLIP-seq
MIRT917714	hsa-miR-23b	CLIP-seq
MIRT917715	hsa-miR-23c	CLIP-seq
MIRT917913	hsa-miR-301a	CLIP-seq
MIRT917914	hsa-miR-301b	CLIP-seq
MIRT917915	hsa-miR-3666	CLIP-seq
MIRT917916	hsa-miR-4295	CLIP-seq
MIRT917917	hsa-miR-454	CLIP-seq
MIRT917918	hsa-miR-4666-3p	CLIP-seq
MIRT917919	hsa-miR-4671-3p	CLIP-seq
MIRT917920	hsa-miR-590-3p	CLIP-seq
MIRT917921	hsa-miR-299-5p	CLIP-seq
MIRT917922	hsa-miR-31	CLIP-seq
MIRT917742	hsa-miR-3192	CLIP-seq
MIRT917923	hsa-miR-3616-5p	CLIP-seq
MIRT917924	hsa-miR-3647-5p	CLIP-seq
MIRT917925	hsa-miR-3663-3p	CLIP-seq
MIRT917926	hsa-miR-3677-5p	CLIP-seq
MIRT917927	hsa-miR-3920	CLIP-seq
MIRT917928	hsa-miR-3921	CLIP-seq
MIRT917782	hsa-miR-3942-3p	CLIP-seq
MIRT917929	hsa-miR-4303	CLIP-seq
MIRT917799	hsa-miR-4420	CLIP-seq
MIRT917930	hsa-miR-4635	CLIP-seq
MIRT917931	hsa-miR-4636	CLIP-seq
MIRT917932	hsa-miR-4653-5p	CLIP-seq
MIRT917933	hsa-miR-4762-3p	CLIP-seq
MIRT917934	hsa-miR-4790-5p	CLIP-seq
MIRT917935	hsa-miR-4802-3p	CLIP-seq
MIRT917936	hsa-miR-573	CLIP-seq
MIRT917937	hsa-miR-593	CLIP-seq
MIRT917938	hsa-miR-633	CLIP-seq
MIRT917691	hsa-miR-148a	CLIP-seq
MIRT917692	hsa-miR-148b	CLIP-seq
MIRT917693	hsa-miR-152	CLIP-seq
MIRT917810	hsa-miR-4474-5p	CLIP-seq
MIRT917837	hsa-miR-4716-3p	CLIP-seq
MIRT917891	hsa-miR-625	CLIP-seq
MIRT917713	hsa-miR-23a	CLIP-seq
MIRT917714	hsa-miR-23b	CLIP-seq
MIRT917715	hsa-miR-23c	CLIP-seq
MIRT1547704	hsa-miR-3143	CLIP-seq
MIRT1547705	hsa-miR-320a	CLIP-seq
MIRT1547706	hsa-miR-320b	CLIP-seq
MIRT1547707	hsa-miR-320c	CLIP-seq
MIRT1547708	hsa-miR-320d	CLIP-seq
MIRT1547709	hsa-miR-4429	CLIP-seq
MIRT1547710	hsa-miR-4705	CLIP-seq
MIRT1547711	hsa-miR-4729	CLIP-seq
MIRT1547712	hsa-miR-543	CLIP-seq
MIRT917670	hsa-miR-101	CLIP-seq
MIRT917688	hsa-miR-141	CLIP-seq
MIRT917689	hsa-miR-144	CLIP-seq
MIRT917701	hsa-miR-200a	CLIP-seq
MIRT917713	hsa-miR-23a	CLIP-seq
MIRT917714	hsa-miR-23b	CLIP-seq
MIRT917715	hsa-miR-23c	CLIP-seq
MIRT917898	hsa-miR-664	CLIP-seq
MIRT917670	hsa-miR-101	CLIP-seq
MIRT917688	hsa-miR-141	CLIP-seq
MIRT917689	hsa-miR-144	CLIP-seq
MIRT917701	hsa-miR-200a	CLIP-seq
MIRT917713	hsa-miR-23a	CLIP-seq
MIRT917714	hsa-miR-23b	CLIP-seq
MIRT917715	hsa-miR-23c	CLIP-seq
MIRT917898	hsa-miR-664	CLIP-seq
MIRT1972066	hsa-miR-1207-3p	CLIP-seq
MIRT1972067	hsa-miR-1228	CLIP-seq
MIRT1972068	hsa-miR-1272	CLIP-seq
MIRT1972069	hsa-miR-143	CLIP-seq
MIRT917711	hsa-miR-221	CLIP-seq
MIRT917712	hsa-miR-222	CLIP-seq
MIRT1972070	hsa-miR-2278	CLIP-seq
MIRT917713	hsa-miR-23a	CLIP-seq
MIRT917714	hsa-miR-23b	CLIP-seq
MIRT917715	hsa-miR-23c	CLIP-seq
MIRT917717	hsa-miR-29a	CLIP-seq
MIRT917718	hsa-miR-29b	CLIP-seq
MIRT917719	hsa-miR-29c	CLIP-seq
MIRT1972071	hsa-miR-3127-3p	CLIP-seq
MIRT1972072	hsa-miR-3145-5p	CLIP-seq
MIRT1972073	hsa-miR-3148	CLIP-seq
MIRT1972074	hsa-miR-3153	CLIP-seq
MIRT917739	hsa-miR-3176	CLIP-seq
MIRT1972075	hsa-miR-3202	CLIP-seq
MIRT1972076	hsa-miR-326	CLIP-seq
MIRT1972077	hsa-miR-330-5p	CLIP-seq
MIRT1972078	hsa-miR-3667-3p	CLIP-seq
MIRT917766	hsa-miR-3714	CLIP-seq
MIRT917777	hsa-miR-3922-3p	CLIP-seq
MIRT1972079	hsa-miR-4267	CLIP-seq
MIRT1972080	hsa-miR-4462	CLIP-seq
MIRT1972081	hsa-miR-4468	CLIP-seq
MIRT917811	hsa-miR-4476	CLIP-seq
MIRT917812	hsa-miR-4484	CLIP-seq
MIRT917813	hsa-miR-4487	CLIP-seq
MIRT917822	hsa-miR-4533	CLIP-seq
MIRT917824	hsa-miR-4646-5p	CLIP-seq
MIRT1972082	hsa-miR-4668-5p	CLIP-seq
MIRT1972083	hsa-miR-4722-5p	CLIP-seq
MIRT917851	hsa-miR-4768-3p	CLIP-seq
MIRT1972084	hsa-miR-4770	CLIP-seq
MIRT1972085	hsa-miR-4775	CLIP-seq
MIRT917857	hsa-miR-4797-5p	CLIP-seq
MIRT917885	hsa-miR-576-3p	CLIP-seq
MIRT917886	hsa-miR-579	CLIP-seq
MIRT917899	hsa-miR-665	CLIP-seq
MIRT1972086	hsa-miR-875-3p	CLIP-seq
MIRT917908	hsa-miR-885-3p	CLIP-seq
MIRT1972087	hsa-miR-940	CLIP-seq
MIRT917673	hsa-miR-1206	CLIP-seq
MIRT917675	hsa-miR-1246	CLIP-seq
MIRT917680	hsa-miR-1275	CLIP-seq
MIRT917688	hsa-miR-141	CLIP-seq
MIRT917701	hsa-miR-200a	CLIP-seq
MIRT917713	hsa-miR-23a	CLIP-seq
MIRT917714	hsa-miR-23b	CLIP-seq
MIRT917715	hsa-miR-23c	CLIP-seq
MIRT2207913	hsa-miR-378g	CLIP-seq
MIRT917779	hsa-miR-3925-3p	CLIP-seq
MIRT917799	hsa-miR-4420	CLIP-seq
MIRT917811	hsa-miR-4476	CLIP-seq
MIRT917814	hsa-miR-4488	CLIP-seq
MIRT917822	hsa-miR-4533	CLIP-seq
MIRT917828	hsa-miR-4665-5p	CLIP-seq
MIRT917833	hsa-miR-4697-5p	CLIP-seq
MIRT917842	hsa-miR-4736	CLIP-seq
MIRT917860	hsa-miR-486-3p	CLIP-seq
MIRT917862	hsa-miR-490-5p	CLIP-seq
MIRT917899	hsa-miR-665	CLIP-seq
MIRT917904	hsa-miR-766	CLIP-seq
MIRT2386601	hsa-miR-1193	CLIP-seq
MIRT917676	hsa-miR-1255a	CLIP-seq
MIRT917677	hsa-miR-1255b	CLIP-seq
MIRT917678	hsa-miR-1265	CLIP-seq
MIRT2386602	hsa-miR-3154	CLIP-seq
MIRT2386603	hsa-miR-3179	CLIP-seq
MIRT917748	hsa-miR-3605-5p	CLIP-seq
MIRT917762	hsa-miR-3689d	CLIP-seq
MIRT2386604	hsa-miR-3691-5p	CLIP-seq
MIRT917773	hsa-miR-3907	CLIP-seq
MIRT917786	hsa-miR-423-3p	CLIP-seq
MIRT2386605	hsa-miR-4434	CLIP-seq
MIRT917815	hsa-miR-4491	CLIP-seq
MIRT2386606	hsa-miR-4516	CLIP-seq
MIRT2386607	hsa-miR-4531	CLIP-seq
MIRT2386608	hsa-miR-4534	CLIP-seq
MIRT917827	hsa-miR-4657	CLIP-seq
MIRT2386609	hsa-miR-4752	CLIP-seq
MIRT917850	hsa-miR-4764-5p	CLIP-seq
MIRT2386610	hsa-miR-4792	CLIP-seq
MIRT2436524	hsa-miR-1183	CLIP-seq
MIRT2436525	hsa-miR-1224-3p	CLIP-seq
MIRT917688	hsa-miR-141	CLIP-seq
MIRT1972069	hsa-miR-143	CLIP-seq
MIRT917701	hsa-miR-200a	CLIP-seq
MIRT1972070	hsa-miR-2278	CLIP-seq
MIRT917713	hsa-miR-23a	CLIP-seq
MIRT917714	hsa-miR-23b	CLIP-seq
MIRT917715	hsa-miR-23c	CLIP-seq
MIRT917727	hsa-miR-3123	CLIP-seq
MIRT1972071	hsa-miR-3127-3p	CLIP-seq
MIRT917733	hsa-miR-3155	CLIP-seq
MIRT917734	hsa-miR-3155b	CLIP-seq
MIRT2436526	hsa-miR-3158-3p	CLIP-seq
MIRT917739	hsa-miR-3176	CLIP-seq
MIRT917740	hsa-miR-3186-5p	CLIP-seq
MIRT1972076	hsa-miR-326	CLIP-seq
MIRT1972077	hsa-miR-330-5p	CLIP-seq
MIRT917751	hsa-miR-361-3p	CLIP-seq
MIRT917752	hsa-miR-361-5p	CLIP-seq
MIRT1972078	hsa-miR-3667-3p	CLIP-seq
MIRT917758	hsa-miR-3675-5p	CLIP-seq
MIRT917766	hsa-miR-3714	CLIP-seq
MIRT2207913	hsa-miR-378g	CLIP-seq
MIRT917776	hsa-miR-3919	CLIP-seq
MIRT917777	hsa-miR-3922-3p	CLIP-seq
MIRT917782	hsa-miR-3942-3p	CLIP-seq
MIRT2436527	hsa-miR-4286	CLIP-seq
MIRT2436528	hsa-miR-4437	CLIP-seq
MIRT2436529	hsa-miR-4446-3p	CLIP-seq
MIRT1972080	hsa-miR-4462	CLIP-seq
MIRT1972081	hsa-miR-4468	CLIP-seq
MIRT917808	hsa-miR-4469	CLIP-seq
MIRT917811	hsa-miR-4476	CLIP-seq
MIRT917813	hsa-miR-4487	CLIP-seq
MIRT917819	hsa-miR-4512	CLIP-seq
MIRT917823	hsa-miR-4640-5p	CLIP-seq
MIRT2436530	hsa-miR-4656	CLIP-seq
MIRT2436531	hsa-miR-4674	CLIP-seq
MIRT2436532	hsa-miR-4676-5p	CLIP-seq
MIRT2436533	hsa-miR-4684-3p	CLIP-seq
MIRT917831	hsa-miR-4690-3p	CLIP-seq
MIRT917832	hsa-miR-4693-3p	CLIP-seq
MIRT2436534	hsa-miR-4709-3p	CLIP-seq
MIRT1972083	hsa-miR-4722-5p	CLIP-seq
MIRT917838	hsa-miR-4726-5p	CLIP-seq
MIRT2436535	hsa-miR-4733-5p	CLIP-seq
MIRT2436536	hsa-miR-4738-5p	CLIP-seq
MIRT917846	hsa-miR-4755-3p	CLIP-seq
MIRT917848	hsa-miR-4756-3p	CLIP-seq
MIRT917849	hsa-miR-4757-5p	CLIP-seq
MIRT917851	hsa-miR-4768-3p	CLIP-seq
MIRT1972084	hsa-miR-4770	CLIP-seq
MIRT917857	hsa-miR-4797-5p	CLIP-seq
MIRT917935	hsa-miR-4802-3p	CLIP-seq
MIRT917859	hsa-miR-484	CLIP-seq
MIRT2436537	hsa-miR-495	CLIP-seq
MIRT2436538	hsa-miR-5095	CLIP-seq
MIRT2436539	hsa-miR-518a-5p	CLIP-seq
MIRT2436540	hsa-miR-527	CLIP-seq
MIRT2436541	hsa-miR-575	CLIP-seq
MIRT2436542	hsa-miR-591	CLIP-seq
MIRT917895	hsa-miR-642a	CLIP-seq
MIRT917899	hsa-miR-665	CLIP-seq
MIRT2436543	hsa-miR-760	CLIP-seq
MIRT917908	hsa-miR-885-3p	CLIP-seq
MIRT1972087	hsa-miR-940	CLIP-seq
MIRT2436524	hsa-miR-1183	CLIP-seq
MIRT917688	hsa-miR-141	CLIP-seq
MIRT917701	hsa-miR-200a	CLIP-seq
MIRT2207913	hsa-miR-378g	CLIP-seq
MIRT917782	hsa-miR-3942-3p	CLIP-seq
MIRT2436528	hsa-miR-4437	CLIP-seq
MIRT917813	hsa-miR-4487	CLIP-seq
MIRT2436531	hsa-miR-4674	CLIP-seq
MIRT2436533	hsa-miR-4684-3p	CLIP-seq
MIRT917832	hsa-miR-4693-3p	CLIP-seq
MIRT2436536	hsa-miR-4738-5p	CLIP-seq
MIRT2436537	hsa-miR-495	CLIP-seq
MIRT2436539	hsa-miR-518a-5p	CLIP-seq
MIRT2436540	hsa-miR-527	CLIP-seq
MIRT1972068	hsa-miR-1272	CLIP-seq
MIRT917710	hsa-miR-219-5p	CLIP-seq
MIRT2447844	hsa-miR-3682-3p	CLIP-seq
MIRT917803	hsa-miR-4445	CLIP-seq
MIRT917856	hsa-miR-4782-3p	CLIP-seq
MIRT917866	hsa-miR-508-3p	CLIP-seq
MIRT2447845	hsa-miR-580	CLIP-seq
MIRT917670	hsa-miR-101	CLIP-seq
MIRT2511124	hsa-miR-1256	CLIP-seq
MIRT2511125	hsa-miR-1257	CLIP-seq
MIRT917680	hsa-miR-1275	CLIP-seq
MIRT917684	hsa-miR-1294	CLIP-seq
MIRT1972069	hsa-miR-143	CLIP-seq
MIRT917689	hsa-miR-144	CLIP-seq
MIRT2511126	hsa-miR-1587	CLIP-seq
MIRT2511127	hsa-miR-186	CLIP-seq
MIRT2511128	hsa-miR-1913	CLIP-seq
MIRT2511129	hsa-miR-1915	CLIP-seq
MIRT2511130	hsa-miR-196a	CLIP-seq
MIRT2511131	hsa-miR-196b	CLIP-seq
MIRT917703	hsa-miR-204	CLIP-seq
MIRT2511132	hsa-miR-205	CLIP-seq
MIRT917704	hsa-miR-2052	CLIP-seq
MIRT917705	hsa-miR-211	CLIP-seq
MIRT2511133	hsa-miR-2113	CLIP-seq
MIRT917706	hsa-miR-2117	CLIP-seq
MIRT917709	hsa-miR-219-2-3p	CLIP-seq
MIRT1972070	hsa-miR-2278	CLIP-seq
MIRT917713	hsa-miR-23a	CLIP-seq
MIRT917714	hsa-miR-23b	CLIP-seq
MIRT917715	hsa-miR-23c	CLIP-seq
MIRT2511134	hsa-miR-2964a-3p	CLIP-seq
MIRT2511135	hsa-miR-3117-5p	CLIP-seq
MIRT917730	hsa-miR-3126-5p	CLIP-seq
MIRT1972074	hsa-miR-3153	CLIP-seq
MIRT917733	hsa-miR-3155	CLIP-seq
MIRT917734	hsa-miR-3155b	CLIP-seq
MIRT2436526	hsa-miR-3158-3p	CLIP-seq
MIRT2511136	hsa-miR-3174	CLIP-seq
MIRT2511137	hsa-miR-3185	CLIP-seq
MIRT917740	hsa-miR-3186-5p	CLIP-seq
MIRT2511138	hsa-miR-3189-3p	CLIP-seq
MIRT2511139	hsa-miR-3189-5p	CLIP-seq
MIRT2511140	hsa-miR-3194-3p	CLIP-seq
MIRT2511141	hsa-miR-324-3p	CLIP-seq
MIRT1972076	hsa-miR-326	CLIP-seq
MIRT1972077	hsa-miR-330-5p	CLIP-seq
MIRT917746	hsa-miR-3545-5p	CLIP-seq
MIRT917749	hsa-miR-3607-5p	CLIP-seq
MIRT917751	hsa-miR-361-3p	CLIP-seq
MIRT917752	hsa-miR-361-5p	CLIP-seq
MIRT2511142	hsa-miR-3646	CLIP-seq
MIRT917758	hsa-miR-3675-5p	CLIP-seq
MIRT917766	hsa-miR-3714	CLIP-seq
MIRT917772	hsa-miR-383	CLIP-seq
MIRT2511143	hsa-miR-3938	CLIP-seq
MIRT2511144	hsa-miR-412	CLIP-seq
MIRT917789	hsa-miR-4270	CLIP-seq
MIRT2511145	hsa-miR-4273	CLIP-seq
MIRT2511146	hsa-miR-4275	CLIP-seq
MIRT917790	hsa-miR-4278	CLIP-seq
MIRT2511147	hsa-miR-4283	CLIP-seq
MIRT2436527	hsa-miR-4286	CLIP-seq
MIRT2511148	hsa-miR-4307	CLIP-seq
MIRT917795	hsa-miR-4316	CLIP-seq
MIRT2511149	hsa-miR-4317	CLIP-seq
MIRT917798	hsa-miR-4419a	CLIP-seq
MIRT2511150	hsa-miR-4427	CLIP-seq
MIRT2436528	hsa-miR-4437	CLIP-seq
MIRT917802	hsa-miR-4441	CLIP-seq
MIRT2436529	hsa-miR-4446-3p	CLIP-seq
MIRT2511151	hsa-miR-4447	CLIP-seq
MIRT2511152	hsa-miR-4448	CLIP-seq
MIRT917806	hsa-miR-4450	CLIP-seq
MIRT1972080	hsa-miR-4462	CLIP-seq
MIRT1972081	hsa-miR-4468	CLIP-seq
MIRT917808	hsa-miR-4469	CLIP-seq
MIRT2511153	hsa-miR-4472	CLIP-seq
MIRT917811	hsa-miR-4476	CLIP-seq
MIRT2511154	hsa-miR-4489	CLIP-seq
MIRT917818	hsa-miR-4510	CLIP-seq
MIRT2511155	hsa-miR-4525	CLIP-seq
MIRT917821	hsa-miR-4527	CLIP-seq
MIRT917823	hsa-miR-4640-5p	CLIP-seq
MIRT2511156	hsa-miR-4641	CLIP-seq
MIRT2436530	hsa-miR-4656	CLIP-seq
MIRT917828	hsa-miR-4665-5p	CLIP-seq
MIRT2511157	hsa-miR-4667-5p	CLIP-seq
MIRT1972082	hsa-miR-4668-5p	CLIP-seq
MIRT2436531	hsa-miR-4674	CLIP-seq
MIRT2511158	hsa-miR-4677-5p	CLIP-seq
MIRT2436533	hsa-miR-4684-3p	CLIP-seq
MIRT917831	hsa-miR-4690-3p	CLIP-seq
MIRT917832	hsa-miR-4693-3p	CLIP-seq
MIRT2511159	hsa-miR-4700-5p	CLIP-seq
MIRT2511160	hsa-miR-4716-5p	CLIP-seq
MIRT1972083	hsa-miR-4722-5p	CLIP-seq
MIRT2511161	hsa-miR-4723-5p	CLIP-seq
MIRT2511162	hsa-miR-4726-3p	CLIP-seq
MIRT917838	hsa-miR-4726-5p	CLIP-seq
MIRT2436536	hsa-miR-4738-5p	CLIP-seq
MIRT917846	hsa-miR-4755-3p	CLIP-seq
MIRT917847	hsa-miR-4755-5p	CLIP-seq
MIRT2511163	hsa-miR-4758-3p	CLIP-seq
MIRT917851	hsa-miR-4768-3p	CLIP-seq
MIRT1972084	hsa-miR-4770	CLIP-seq
MIRT2511164	hsa-miR-4772-5p	CLIP-seq
MIRT917853	hsa-miR-4774-5p	CLIP-seq
MIRT1972085	hsa-miR-4775	CLIP-seq
MIRT917855	hsa-miR-4780	CLIP-seq
MIRT917935	hsa-miR-4802-3p	CLIP-seq
MIRT917859	hsa-miR-484	CLIP-seq
MIRT917860	hsa-miR-486-3p	CLIP-seq
MIRT917864	hsa-miR-494	CLIP-seq
MIRT2436537	hsa-miR-495	CLIP-seq
MIRT2436539	hsa-miR-518a-5p	CLIP-seq
MIRT917879	hsa-miR-522	CLIP-seq
MIRT2436540	hsa-miR-527	CLIP-seq
MIRT2511165	hsa-miR-548q	CLIP-seq
MIRT2511166	hsa-miR-570	CLIP-seq
MIRT917885	hsa-miR-576-3p	CLIP-seq
MIRT2436542	hsa-miR-591	CLIP-seq
MIRT2511167	hsa-miR-607	CLIP-seq
MIRT2511168	hsa-miR-615-5p	CLIP-seq
MIRT917890	hsa-miR-623	CLIP-seq
MIRT917891	hsa-miR-625	CLIP-seq
MIRT2511169	hsa-miR-635	CLIP-seq
MIRT2511170	hsa-miR-637	CLIP-seq
MIRT917895	hsa-miR-642a	CLIP-seq
MIRT917898	hsa-miR-664	CLIP-seq
MIRT917899	hsa-miR-665	CLIP-seq
MIRT2511171	hsa-miR-711	CLIP-seq
MIRT2511172	hsa-miR-758	CLIP-seq
MIRT2436543	hsa-miR-760	CLIP-seq
MIRT2511173	hsa-miR-921	CLIP-seq
MIRT1972087	hsa-miR-940	CLIP-seq
MIRT917919	hsa-miR-4671-3p	CLIP-seq
MIRT917670	hsa-miR-101	CLIP-seq
MIRT2511124	hsa-miR-1256	CLIP-seq
MIRT2511125	hsa-miR-1257	CLIP-seq
MIRT2678835	hsa-miR-1269	CLIP-seq
MIRT2678836	hsa-miR-1269b	CLIP-seq
MIRT917680	hsa-miR-1275	CLIP-seq
MIRT2678837	hsa-miR-1288	CLIP-seq
MIRT917684	hsa-miR-1294	CLIP-seq
MIRT917685	hsa-miR-1303	CLIP-seq
MIRT2678838	hsa-miR-1305	CLIP-seq
MIRT1972069	hsa-miR-143	CLIP-seq
MIRT917689	hsa-miR-144	CLIP-seq
MIRT2511126	hsa-miR-1587	CLIP-seq
MIRT2511127	hsa-miR-186	CLIP-seq
MIRT2511128	hsa-miR-1913	CLIP-seq
MIRT917697	hsa-miR-1914	CLIP-seq
MIRT2511129	hsa-miR-1915	CLIP-seq
MIRT2678839	hsa-miR-198	CLIP-seq
MIRT917703	hsa-miR-204	CLIP-seq
MIRT2511132	hsa-miR-205	CLIP-seq
MIRT917704	hsa-miR-2052	CLIP-seq
MIRT917705	hsa-miR-211	CLIP-seq
MIRT2511133	hsa-miR-2113	CLIP-seq
MIRT917706	hsa-miR-2117	CLIP-seq
MIRT917709	hsa-miR-219-2-3p	CLIP-seq
MIRT917711	hsa-miR-221	CLIP-seq
MIRT917712	hsa-miR-222	CLIP-seq
MIRT1972070	hsa-miR-2278	CLIP-seq
MIRT917713	hsa-miR-23a	CLIP-seq
MIRT917714	hsa-miR-23b	CLIP-seq
MIRT917715	hsa-miR-23c	CLIP-seq
MIRT2511134	hsa-miR-2964a-3p	CLIP-seq
MIRT2511135	hsa-miR-3117-5p	CLIP-seq
MIRT917727	hsa-miR-3123	CLIP-seq
MIRT917730	hsa-miR-3126-5p	CLIP-seq
MIRT2678840	hsa-miR-3138	CLIP-seq
MIRT1972074	hsa-miR-3153	CLIP-seq
MIRT917733	hsa-miR-3155	CLIP-seq
MIRT917734	hsa-miR-3155b	CLIP-seq
MIRT2436526	hsa-miR-3158-3p	CLIP-seq
MIRT2511136	hsa-miR-3174	CLIP-seq
MIRT2511137	hsa-miR-3185	CLIP-seq
MIRT917740	hsa-miR-3186-5p	CLIP-seq
MIRT2511138	hsa-miR-3189-3p	CLIP-seq
MIRT2511139	hsa-miR-3189-5p	CLIP-seq
MIRT2511140	hsa-miR-3194-3p	CLIP-seq
MIRT1972075	hsa-miR-3202	CLIP-seq
MIRT2511141	hsa-miR-324-3p	CLIP-seq
MIRT1972076	hsa-miR-326	CLIP-seq
MIRT1972077	hsa-miR-330-5p	CLIP-seq
MIRT917746	hsa-miR-3545-5p	CLIP-seq
MIRT917749	hsa-miR-3607-5p	CLIP-seq
MIRT917751	hsa-miR-361-3p	CLIP-seq
MIRT917752	hsa-miR-361-5p	CLIP-seq
MIRT2511142	hsa-miR-3646	CLIP-seq
MIRT917758	hsa-miR-3675-5p	CLIP-seq
MIRT917761	hsa-miR-3686	CLIP-seq
MIRT917766	hsa-miR-3714	CLIP-seq
MIRT917772	hsa-miR-383	CLIP-seq
MIRT917778	hsa-miR-3923	CLIP-seq
MIRT917780	hsa-miR-3925-5p	CLIP-seq
MIRT2511143	hsa-miR-3938	CLIP-seq
MIRT2678841	hsa-miR-410	CLIP-seq
MIRT2511144	hsa-miR-412	CLIP-seq
MIRT917789	hsa-miR-4270	CLIP-seq
MIRT2511145	hsa-miR-4273	CLIP-seq
MIRT2511146	hsa-miR-4275	CLIP-seq
MIRT917790	hsa-miR-4278	CLIP-seq
MIRT2511147	hsa-miR-4283	CLIP-seq
MIRT2436527	hsa-miR-4286	CLIP-seq
MIRT2511148	hsa-miR-4307	CLIP-seq
MIRT917795	hsa-miR-4316	CLIP-seq
MIRT2511149	hsa-miR-4317	CLIP-seq
MIRT917798	hsa-miR-4419a	CLIP-seq
MIRT2511150	hsa-miR-4427	CLIP-seq
MIRT2436528	hsa-miR-4437	CLIP-seq
MIRT917802	hsa-miR-4441	CLIP-seq
MIRT2436529	hsa-miR-4446-3p	CLIP-seq
MIRT2511151	hsa-miR-4447	CLIP-seq
MIRT2511152	hsa-miR-4448	CLIP-seq
MIRT917806	hsa-miR-4450	CLIP-seq
MIRT1972080	hsa-miR-4462	CLIP-seq
MIRT1972081	hsa-miR-4468	CLIP-seq
MIRT2511153	hsa-miR-4472	CLIP-seq
MIRT917811	hsa-miR-4476	CLIP-seq
MIRT2511154	hsa-miR-4489	CLIP-seq
MIRT917818	hsa-miR-4510	CLIP-seq
MIRT2678842	hsa-miR-4515	CLIP-seq
MIRT2511155	hsa-miR-4525	CLIP-seq
MIRT917821	hsa-miR-4527	CLIP-seq
MIRT917823	hsa-miR-4640-5p	CLIP-seq
MIRT2511156	hsa-miR-4641	CLIP-seq
MIRT917825	hsa-miR-4648	CLIP-seq
MIRT917826	hsa-miR-4654	CLIP-seq
MIRT2436530	hsa-miR-4656	CLIP-seq
MIRT917828	hsa-miR-4665-5p	CLIP-seq
MIRT2511157	hsa-miR-4667-5p	CLIP-seq
MIRT1972082	hsa-miR-4668-5p	CLIP-seq
MIRT2436531	hsa-miR-4674	CLIP-seq
MIRT2511158	hsa-miR-4677-5p	CLIP-seq
MIRT2436533	hsa-miR-4684-3p	CLIP-seq
MIRT917832	hsa-miR-4693-3p	CLIP-seq
MIRT2511159	hsa-miR-4700-5p	CLIP-seq
MIRT2511160	hsa-miR-4716-5p	CLIP-seq
MIRT1972083	hsa-miR-4722-5p	CLIP-seq
MIRT2511161	hsa-miR-4723-5p	CLIP-seq
MIRT2511162	hsa-miR-4726-3p	CLIP-seq
MIRT917838	hsa-miR-4726-5p	CLIP-seq
MIRT2436536	hsa-miR-4738-5p	CLIP-seq
MIRT2678843	hsa-miR-4740-5p	CLIP-seq
MIRT917843	hsa-miR-4742-3p	CLIP-seq
MIRT2678844	hsa-miR-4747-5p	CLIP-seq
MIRT2386609	hsa-miR-4752	CLIP-seq
MIRT917845	hsa-miR-4753-3p	CLIP-seq
MIRT917847	hsa-miR-4755-5p	CLIP-seq
MIRT2511163	hsa-miR-4758-3p	CLIP-seq
MIRT917851	hsa-miR-4768-3p	CLIP-seq
MIRT917852	hsa-miR-4769-5p	CLIP-seq
MIRT1972084	hsa-miR-4770	CLIP-seq
MIRT2511164	hsa-miR-4772-5p	CLIP-seq
MIRT917853	hsa-miR-4774-5p	CLIP-seq
MIRT1972085	hsa-miR-4775	CLIP-seq
MIRT917855	hsa-miR-4780	CLIP-seq
MIRT2678845	hsa-miR-4800-5p	CLIP-seq
MIRT917935	hsa-miR-4802-3p	CLIP-seq
MIRT2678846	hsa-miR-4803	CLIP-seq
MIRT917859	hsa-miR-484	CLIP-seq
MIRT917860	hsa-miR-486-3p	CLIP-seq
MIRT917861	hsa-miR-488	CLIP-seq
MIRT917864	hsa-miR-494	CLIP-seq
MIRT2436537	hsa-miR-495	CLIP-seq
MIRT2678847	hsa-miR-509-3p	CLIP-seq
MIRT2436539	hsa-miR-518a-5p	CLIP-seq
MIRT917879	hsa-miR-522	CLIP-seq
MIRT2436540	hsa-miR-527	CLIP-seq
MIRT917880	hsa-miR-539	CLIP-seq
MIRT2511165	hsa-miR-548q	CLIP-seq
MIRT917884	hsa-miR-548v	CLIP-seq
MIRT2511166	hsa-miR-570	CLIP-seq
MIRT917885	hsa-miR-576-3p	CLIP-seq
MIRT2436542	hsa-miR-591	CLIP-seq
MIRT2511167	hsa-miR-607	CLIP-seq
MIRT2511168	hsa-miR-615-5p	CLIP-seq
MIRT917890	hsa-miR-623	CLIP-seq
MIRT917891	hsa-miR-625	CLIP-seq
MIRT917892	hsa-miR-628-3p	CLIP-seq
MIRT2678848	hsa-miR-629	CLIP-seq
MIRT2511169	hsa-miR-635	CLIP-seq
MIRT2511170	hsa-miR-637	CLIP-seq
MIRT917895	hsa-miR-642a	CLIP-seq
MIRT917898	hsa-miR-664	CLIP-seq
MIRT917899	hsa-miR-665	CLIP-seq
MIRT2511171	hsa-miR-711	CLIP-seq
MIRT2511172	hsa-miR-758	CLIP-seq
MIRT2436543	hsa-miR-760	CLIP-seq
MIRT2511173	hsa-miR-921	CLIP-seq
MIRT1972087	hsa-miR-940	CLIP-seq

Show/Hide all (6)

Transcription factor	Regulation	Reference
ESR1	Unknown	18563714
FOXF2	Activation	19562724
HIF1A	Unknown	12384916
NFKB1	Activation	17530707
RELA	Activation	17530707
SNAI2	Activation	22074556

Show/Hide all (78)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0001764	Process	Neuron migration	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0005102	Function	Signaling receptor binding	TAS	10358157, 10438529
GO:0005125	Function	Cytokine activity	IEA
GO:0005178	Function	Integrin binding	IDA	29301984
GO:0005515	Function	Protein binding	IPI	28381538
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	8752281
GO:0005615	Component	Extracellular space	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	TAS	10772939
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	12782716
GO:0006952	Process	Defense response	IEA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	10802710
GO:0007155	Process	Cell adhesion	TAS	10198043
GO:0007165	Process	Signal transduction	TAS	10491003
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8752280
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	34239069, 39093700
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	ISS
GO:0007411	Process	Axon guidance	IBA
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IDA	8752281, 18308860, 39093700
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	IMP	27400149
GO:0008009	Function	Chemokine activity	TAS	10772939, 12782716
GO:0008015	Process	Blood circulation	TAS	10772939
GO:0008064	Process	Regulation of actin polymerization or depolymerization	TAS	10570282
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008344	Process	Adult locomotory behavior	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009615	Process	Response to virus	TAS	10772939
GO:0009897	Component	External side of plasma membrane	IBA
GO:0010818	Process	T cell chemotaxis	IDA	17088326
GO:0022029	Process	Telencephalon cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0031012	Component	Extracellular matrix	HDA	25037231
GO:0031100	Process	Animal organ regeneration	IEA
GO:0031640	Process	Killing of cells of another organism	IDA	12949249
GO:0033603	Process	Positive regulation of dopamine secretion	IEA
GO:0033622	Process	Integrin activation	IDA	29301984
GO:0038146	Process	Chemokine (C-X-C motif) ligand 12 signaling pathway	IMP	27400149
GO:0038160	Process	CXCL12-activated CXCR4 signaling pathway	IDA	39093700
GO:0038160	Process	CXCL12-activated CXCR4 signaling pathway	IGI	27693460
GO:0042379	Function	Chemokine receptor binding	IMP	22457824
GO:0043434	Process	Response to peptide hormone	IEA
GO:0045236	Function	CXCR chemokine receptor binding	IBA
GO:0045236	Function	CXCR chemokine receptor binding	IDA	20388803
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045785	Process	Positive regulation of cell adhesion	IDA	23620790
GO:0048842	Process	Positive regulation of axon extension involved in axon guidance	IEA
GO:0050921	Process	Positive regulation of chemotaxis	IEA
GO:0050930	Process	Induction of positive chemotaxis	IBA
GO:0050965	Process	Detection of temperature stimulus involved in sensory perception of pain	IEA
GO:0050966	Process	Detection of mechanical stimulus involved in sensory perception of pain	IEA
GO:0051924	Process	Regulation of calcium ion transport	IEA
GO:0060326	Process	Cell chemotaxis	IBA
GO:0060326	Process	Cell chemotaxis	IDA	19106094
GO:0060326	Process	Cell chemotaxis	IDA	18308860
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12949249
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IDA	20388803
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IDA	18802065
GO:0090280	Process	Positive regulation of calcium ion import	IEA
GO:0090280	Process	Positive regulation of calcium ion import	TAS	10925302
GO:1902230	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IDA	20388803
GO:1903237	Process	Negative regulation of leukocyte tethering or rolling	IDA	18308860
GO:1904018	Process	Positive regulation of vasculature development	IMP	27693460
GO:1990478	Process	Response to ultrasound	IEA
GO:1990869	Process	Cellular response to chemokine	IMP	27400149
GO:2000406	Process	Positive regulation of T cell migration	IDA	23620790
GO:2000669	Process	Negative regulation of dendritic cell apoptotic process	IDA	15059845

MIM	HGNC	e!Ensembl
600835	10672	ENSG00000107562

P48061

Protein name

Stromal cell-derived factor 1 (SDF-1) (hSDF-1) (C-X-C motif chemokine 12) (Intercrine reduced in hepatomas) (IRH) (hIRH) (Pre-B cell growth-stimulating factor) (PBSF) [Cleaved into: SDF-1-beta(3-72); SDF-1-alpha(3-67)]

Protein function

Chemoattractant active on T-lymphocytes and monocytes but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. SDF-1-beta(3-72) and SDF-1-al

PDB

1A15 , 1QG7 , 1SDF , 1VMC , 2J7Z , 2K01 , 2K03 , 2K04 , 2K05 , 2KEC , 2KED , 2KEE , 2KOL , 2N55 , 2NWG , 2SDF , 3GV3 , 3HP3 , 4LMQ , 4UAI , 6SHR , 7SK3 , 7SK4 , 7SK5 , 7SK6 , 7SK7 , 7SK8 , 8K3Z , 8U4O

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00048	IL8	28 → 86	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform Alpha and isoform Beta are ubiquitously expressed, with highest levels detected in liver, pancreas and spleen. Isoform Gamma is mainly expressed in heart, with weak expression detected in several other tissues. Isoform Delta, i

Sequence

MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway NF-kappa B signaling pathway Axon guidance Leukocyte transendothelial migration Intestinal immune network for IgA production Regulation of actin cytoskeleton Human cytomegalovirus infection Pathways in cancer Rheumatoid arthritis		Nuclear signaling by ERBB4 Signaling by ROBO receptors Chemokine receptors bind chemokines G alpha (i) signalling events Estrogen-dependent gene expression

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (22)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC PERIODONTITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CXCL12-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC ANGIOPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC PERIPHERAL ANGIOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Susceptibility to HIV infection	protective; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION, LEFT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (658)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	22044645, 31559838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	30365110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	23653000, 25072364, 30453100, 31186715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28755135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adamantinous Craniopharyngioma	Adamantinous Craniopharyngioma	BEFREE	24934367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17082613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	20378003, 21584490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	27212031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26338423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	20462600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11443213, 18351386, 20309720, 28418886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	18351386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	18351386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	20483910, 27986950, 28336327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	22359672	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	23653000, 25072364, 31186715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	29954928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	12115499, 19927352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	23497290, 25400097, 26744909, 29771176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	Pubtator	15026312, 18556651	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	21847578, 28765149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolar capillary dysplasia	Alveolar capillary dysplasia	Pubtator	35649494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30080220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	15388584	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	22560596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	33213069	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	23335032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	18089812, 21752897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	25800732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26330165, 26976451, 27986950, 28581520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	18191726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	34489952	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28567007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28567007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	36519232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	25800732, 26346005	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	24876351, 25800732, 26346005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Calcification of	Aortic valve disease	Pubtator	40008515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Disease	Aortic valve disease	Pubtator	24834915	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	37175670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	10666407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	16227796, 17673719, 19821058, 21415067, 22137643, 22142194, 22386691, 24751515, 28923781, 29304539, 31145896, 31662443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	11817585, 12096225, 16045736, 19774645, 23935208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	15681827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	16045736	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11817585	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12384916, 12588667, 15382150, 16507142, 17393416, 17530707, 21753787, 22275188, 27036513, 32111105, 32901877, 36398072	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29482663	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	31116013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11039580, 17848170, 24024210, 25441632, 29680839, 31020662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	12765425, 24024210, 26207385, 35720028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10656438, 18512766, 19336886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	15382150, 19336886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	10666407, 19745163, 29685964, 35055054, 36519232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	16227796, 17673719, 19821058, 21415067, 22137643, 22142194, 22386691, 24751515, 28923781, 29304539, 31145896, 31662443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	17340464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	22044645, 29535140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	22044645, 36398072	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	BEFREE	15026622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29475239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	12746476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	22142194, 22311941, 23618162, 26216880, 27006446, 27392463, 27580404, 29111236, 30149101, 31747563		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	10068655, 16038794, 31020662		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	16840734, 30416684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	LHGDN	17099730		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	24894780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile Duct Diseases	Bile duct disease	Pubtator	15048728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	29448202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21771725, 22982413, 23526079, 24291546, 26782415, 29022185, 29526013, 30015971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	25393253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	10666407, 19006565	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	12771933, 22173290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	LHGDN	15753365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	25302610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	29751775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	25660395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	29751775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	10656438, 12485835, 17875698, 19336886, 23244149, 24335554, 24934367, 26299663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	12485835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	19625779, 23244149, 24934367, 29849822	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	22430135	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12626353, 12935890, 15081542, 15516962, 15805285, 15809737, 15882617, 15978329, 15987445, 16061624, 17143542, 17517823, 17724466, 17959712, 18223219 View all (68 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	18521742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15987445, 18670789, 19497995, 19513569, 19927352, 20043041, 20109227, 20181250, 20531309, 21087507, 21695171, 22220212, 22767589, 23543442, 23577100 View all (35 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	24335925	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	32188473	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	28446556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	19059110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	21233340, 28701189, 31718614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	32281423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	16565322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bursitis	Bursitis	BEFREE	16779827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	32498363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Urinary Tract	Urinary Tract Cancer	BEFREE	27265091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22954782, 24929539, 25400739, 34358255, 35083551, 35114976, 36211359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15837745, 15882617, 17346539, 18351386, 18558091, 20386750, 20877573, 21960286, 28418886, 29285291, 30012106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	26296527	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	28987144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12149145, 17075975, 17259344, 18954561, 24614035, 25363530, 28102846, 31415486, 31746344, 32730361, 34085699, 34238253, 38057830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36938723	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	23495012, 26415052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	21771725, 22982413, 23526079, 24291546, 26782415, 29022185, 29526013, 30015971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	19834823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15955592, 19302975, 20147779, 20378003, 21292343, 24022841, 25775124, 26517240, 27035564, 28535157, 28721072, 29032612, 29312699, 30182340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	17926037, 20460402, 21410972, 28852723, 35545781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	21527066	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31731384, 33958847, 35180880, 36881486, 40019403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	13130466, 23039915, 32775427, 34358255, 37010151, 37540227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22699780	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	25422203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26296527	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	16857992, 26296527, 28987144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	28277316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15921680, 20460402, 22025564, 22241961, 23372646, 23615713, 24762228, 25320277, 26103953, 28413458, 28753202, 30181917, 30191987, 30822630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	18453750, 19688824, 21482691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	27463607	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	30837882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	19438749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	21559538, 22137643, 22386691, 24725463, 27463607, 27607427, 31662443, 31804579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24725463, 27463607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	18060801	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	16227796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	18060801	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	11817585, 27356492, 33773470	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	30942441	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	29751775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	12122049, 27982773, 29123467, 31368195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	33880887	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	17474298, 20854168, 26780459, 27006446, 27991729, 28526531, 30213507, 30760134, 31564240, 31605718, 31823888		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	19788587, 25672413, 26191295, 26970955, 27697997, 28074045, 29417588, 30320394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	25422203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19788587, 25672413, 26191295, 26970955, 27697997, 28074045, 29417588, 30320394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	23653000, 25072364, 31186715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	23497290, 25400097, 26744909, 29771176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	16565491, 22664794, 31059778, 31361379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	16792547, 17461449, 22727731, 29448202, 31059778, 31361379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	17461449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	17461449	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	18814143, 20102637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	LHGDN	18814143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	20102637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	27072875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	27072875	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	24450273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	22673496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	23615182, 31312972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	24637920, 30021207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11023495, 16840734, 16923552, 19446733, 19491390, 20335218, 20661426, 25294819, 25895128, 27173875, 27637890, 28526063, 29379494, 29665227, 29705266, 30155533, 30416684 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	12783211, 16923552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	19006565, 25043017, 28903325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	CTD_human_DG	20731768		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Periodontitis	Periodontitis	Pubtator	24126519	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Periodontitis	Periodontitis	Pubtator	30922293, 33869630	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	20109310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	26996902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	30826602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Citrullinemia	Citrullinemia	Pubtator	35612662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	22699780		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	LHGDN	12834106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31286993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16568088, 17143542, 18512766, 19588204, 22871210, 26552750, 26678887, 28418886, 28739729, 28811711, 29305742, 31500630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17143542, 17982648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	20865359	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	28811711, 29305742, 36246978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16125170, 16568088, 16641550, 17143542, 17982648, 18558091, 20177796, 20877573, 21349176, 23042611, 23098564, 24238971, 24629239, 25150783, 26406413 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17982648, 18416455, 20865359, 21349176, 21350711, 23098564, 24629239, 26078947, 26678887, 27503580, 27798120, 28739729, 28811711, 29305742, 30243491 View all (11 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18443596, 18558091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20798912, 27160279, 34233297	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	29414663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	BEFREE	28559980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	31059778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	19628780, 29106576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	22673496, 23429605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17083723, 18189328, 19796655, 24032722, 24943683, 28279221, 29218250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal neovascularization	Pubtator	26727921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	30321512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	11500196, 21415067, 22386691, 24361877, 24950177, 25804320, 26133117, 28154007, 28189264, 30012324, 30180964		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	21378990		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	11500196, 16480760, 19363666, 21415067, 22137643, 22216278, 22386691, 24361877, 24950177, 25804320, 26133117, 27463607, 27607427, 28154007, 28189264 View all (5 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	21378990		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	22216278, 25060794, 25660395, 27463607, 30012324, 30844764, 36435092, 39445733	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	30859801	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease Autosomal Dominant 1	Coronary artery disease	Pubtator	22216278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Vasospasm	Coronary Artery Vasospasm	BEFREE	29771429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	21804106, 22042884, 24950177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	11500196, 21415067, 21804106, 22042884, 22137643, 22386691, 24361877, 24950177, 25804320, 26133117, 28154007, 28189264, 28978175, 30012324, 30180964		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOOSTEOARTHROPATHY	Cranioosteoarthropathy	BEFREE	25441632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	BEFREE	24934367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	24934367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11095335, 19109200, 19774645, 24687413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	34857759	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	23381805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	27167239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	30905425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	Pubtator	30905425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11817585, 15965952, 16507142, 17393416, 20609598, 21753787, 24448516, 24516346, 24635637, 27356492, 28131784, 28236026, 28426786, 28714028, 28994112 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	15965952, 17949547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	16944452, 31505255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	32303038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	23732617, 29283028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	29596844	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	32699209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	CTD_human_DG	27206134		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis	Dermatitis	Pubtator	27206134	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	26296527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11334429, 14522095, 25495026, 27580404, 28783870, 29119710, 29132746, 30025786, 31312972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11334429, 14522095, 25495026, 27580404, 28137917, 28412763, 28783870, 29119710, 29132746, 30025786, 30477146, 31312972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	30184318, 34566972, 34935260, 39512693, 40447619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	27406064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27896979, 30764545, 35281591, 35958564, 38569426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	39819718	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11334429, 14522095, 15699497, 15843397, 17509149, 19476565, 22311941, 30149101, 30447278, 31267721		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	LHGDN	15699497		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21968974, 25085744, 27580404, 29893194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	33858824, 39512693, 40429625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27475229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuralgia	Diabetic Neuralgia	BEFREE	29533926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30870116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	29954928, 30373149, 31096215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysautonomia, Familial	Dysautonomia	BEFREE	28765024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	27597234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	16227796, 31145896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	19819721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	28402926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	21607621, 22025313, 28239742, 28285568, 28402926, 29383153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Diseases	Endometrial Diseases	BEFREE	30106199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	17362937, 22025313, 24407584, 24416254, 26678890, 32641130, 38232115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	20720261, 23517860, 23650939, 24534089, 27729562, 27959395, 28285568, 29161347, 29450941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	23517860, 27959395, 29161347, 32439908, 35388025, 36524127, 38035102	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	27729562	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	28658176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa	Epidermolysis Bullosa	BEFREE	28094098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa	Epidermolysis bullosa	Pubtator	28094098	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	28104461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28753202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	30168617, 30477146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26130416, 28193907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	24074251, 27041792, 31385574, 35264069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26130416, 28193907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	17171785, 19550128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	30180964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	18537159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29217140, 29518606, 30447648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	29581772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Freeman-Sheldon syndrome	Freeman-Sheldon Syndrome	BEFREE	30530236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	33932991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	22553346, 29448202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	29151075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	24120239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	26936919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Genetic Predisposition to Disease	Genetic predisposition to disease	Pubtator	15536153	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	31412792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	15607894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	15607894	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10656438, 15921680, 16547494, 17108064, 17549698, 18512766, 19212671, 20392929, 22427929, 23231075, 23335032, 24023874, 24335554, 25326893, 25860928 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	12702590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	12761880, 17108064, 19923906, 20392929, 22427929, 24023874, 25860928, 26608373, 31504251, 32346064, 33571109, 39300240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37757768	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10656438, 15921680, 16547494, 17549698, 20392929, 22427929, 23231075, 23335032, 23381805, 24023874, 24335554, 25326893, 25860928, 25962108, 26608373 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	12388552, 16760646, 17611402, 19336886, 19923906, 21084856, 23865743, 24970694, 26782381, 32035133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15967572, 16033774, 16835250, 17875698, 19074827, 19336886, 20554030, 21618540, 22083878, 23335032, 23494875, 26277915, 26782381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	16033774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	36793719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	29310647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	28765149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	27471912	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	27471912, 40640313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	18386165, 21380786, 26374452, 29061496, 29749473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	18386165, 19834823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29784000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	23429605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	25060794, 26056125, 37909603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	17070589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	40474296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	29212254, 29903571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	16818471, 31292126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematuria, Benign Familial	Hematuria	BEFREE	7055992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	25055351	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	22232208, 22660553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	15048728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	15048728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	15261139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	12115499, 19927352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	19927352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	25822971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	20009035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypereosinophilia	Hypereosinophilia	BEFREE	30106292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	21801807, 29132746, 29432190, 30748094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	26010611	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	25085744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	31862910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30180964, 31173066, 31312972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogammaglobulinemia	Hypogammaglobulinemia	BEFREE	15026312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets, X-Linked Dominant	Hypophosphatemic Rickets	BEFREE	26612624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12384916, 17442415, 17594938, 18351386, 20631377, 22767589, 26878134	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16929169, 20068066, 20102637, 25405996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23798675	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	15019705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	18930992, 19628780, 29617176, 29693117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	20067420, 28179498, 28979687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	20483575, 20646340	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	32843095, 32899090, 34689792, 39991151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	23078136, 26587874, 31053569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10698152, 10786999, 15454484, 18558091, 20148920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11095335, 19774645, 24687413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	37473877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	19013212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	27220474, 32901877	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	31173219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	20032431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	28418886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	29557746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	20881566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	25471741, 31361379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intussusception	Intussusception	BEFREE	30950188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	19438749, 25400746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	11095335, 24687413, 31377592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	23429605, 28379992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28487111, 29500940, 29751775, 29896417, 31564240, 31605718, 31820348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	9662191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	30489627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	27475229, 30385042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	18268039, 23794207, 28688148, 29500940, 30624740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	23615182, 31312972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	LHGDN	11953881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	11953881, 36551144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	19834823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	30021207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	34987094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10452968, 12935890, 25070183, 25312253, 26542893, 27154815, 28045930, 28574591, 31669202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11023495, 20145264, 21079155, 21486864, 22351695, 22613469, 22842611, 25360637, 26806619, 27903985, 33127669, 34619434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15618475	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	22173290, 23798675, 24855276, 28084439, 32580317, 33906294, 34115113, 34840706, 37541212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	34092614	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	10997965	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15054042, 16818471, 17715399, 18769446, 21607655, 23473997, 23798675, 24372262, 24851270, 25237195, 25294819, 25312253, 25835070, 26212080, 26742943 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	16818471, 17805324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	22438253, 30809033, 31700087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	21442287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	18383856, 19373784, 20695076, 24236200, 25536052, 25866764, 30385376, 31423170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17075975, 17259344, 17413295, 18205260, 19327121, 21465475, 24658853, 25909286, 27066828, 27693460, 27913861, 28302149, 28789425, 29741398, 29783989 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18365549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	19363144, 28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	15048728, 30447648	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	30826602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	21753787, 33815355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	12746476, 15048728, 27832196, 29880273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	29880273	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	19496198, 31515741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	17259344, 20877573, 31304690, 31362469, 31415486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	28749367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30410593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	37606981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	14672915, 15955592, 17916907, 18502034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20124221, 20378003, 25268356, 25775124, 26517240, 29032612, 30182340, 33637678, 36140747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	25775124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	19826912, 22311941, 28755405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17964973, 20722038, 23764537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	19826912, 22311941, 28755405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	17964973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18191726, 19826912, 22095608, 22311941, 23244336, 28755405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	20722038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	27392463, 29111236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	19826912, 22311941, 28755405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18670789, 20571966	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18781098, 20032431, 21527066, 21633638, 24416254, 24810923, 25220301, 25400739, 26715277, 26722521, 28533662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	21584490, 22932666, 29434873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25422203	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	15223017, 22186993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	LHGDN	15223017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10772680, 11714836, 15223017, 15454484, 22186993, 29903571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	15223017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	18354239, 26878134, 36713377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	33881493	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	28202459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	10068655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	10068655, 11431337, 17049119, 19927352, 30197351, 30685602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	10068655, 19927352, 30197351, 30685602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	21847578	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30870525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	28337946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	18386165, 21380786, 26374452, 29061496, 29749473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	LHGDN	14871974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	19309551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	25162674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	19309551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12626353, 12935890, 15081542, 15516962, 15805285, 15809737, 15978329, 15987445, 16061624, 17143542, 17517823, 17724466, 17959712, 18223219, 18781150 View all (67 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	18521742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	21607621, 22025313, 28285568, 28402926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26130416, 28193907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	29448202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	11953881, 24991762, 27212031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	19834823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31746344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15955592, 19302975, 20147779, 20378003, 21292343, 24022841, 25775124, 26517240, 27035564, 27265091, 28535157, 28721072, 29032612, 29312699, 30182340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	18383856, 19373784, 20695076, 24236200, 25536052, 25866764, 30385376, 31423170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15921680, 20725999, 22025564, 22241961, 22549810, 23372646, 23615713, 24762228, 25320277, 26103953, 28413458, 28753202, 30181917, 30191987, 30822630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10999740, 12761880, 15978329, 20462600, 22450749, 23672538, 23740244, 24033967, 24594697, 25605248, 26044561, 27542220, 28336327, 29434873, 30337520, 31275385 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12761880, 15328206, 15467730, 15816537, 16005185, 16114056, 17034033, 17785557, 18337451, 18452560, 18836306, 19064579, 20166978, 21281819, 21607288 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17785557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	BEFREE	22847686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18453750, 21482691, 21633638, 21960286, 22806902, 23258739, 24929539, 25220301, 27147244, 28281844, 28533662, 31273931, 31650323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21771725, 22982413, 23526079, 24291546, 26782415, 29022185, 29526013, 30015971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11328308, 12586845, 15756007, 15955592, 16125170, 17143542, 17320408, 17415525, 17517823, 17785557, 17898181, 18065393, 18155192, 18354239, 18383856 View all (101 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	28055968, 29020982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19788587, 25672413, 26191295, 26970955, 27697997, 28074045, 29417588, 30320394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17143542, 19588204, 22871210, 25960214, 26552750, 26678887, 28418886, 28739729, 28811711, 29305742, 31500630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	18521742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	BEFREE	31140748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	12586845, 18670789, 20109227, 22266857, 23993096, 24886617, 28694161, 28929029, 29263923, 29321662, 29720724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15235108, 15805285, 15809737, 15917309, 15978329, 15987445, 16857992, 17409218, 18223219, 18502034, 18829537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	18521742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	18521742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	23231952, 26350264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	28418886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	22173290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	29112684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	23497290, 25400097, 26744909, 29771176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	23497290, 37875069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15756007, 16397238, 16794396, 25211166, 27167239, 30099017		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15843590, 16929176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16397238, 16794396, 16929176, 19293150, 23538388, 31324252, 35295096, 36087066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meleda Disease	Meleda Disease	BEFREE	16944452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	29508174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	17108064, 21316111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	17108064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28392482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	21294125	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	19309551, 21294125	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	24842333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	40429625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	12761880, 27729562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	18310089, 18383856, 20695076, 25866764, 35421271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	18383856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	17936060, 28840842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	18354239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	15753365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	15813853, 16923552, 17119115, 18227351, 20015878, 22711564, 23354012, 23456977, 23711392, 24072855, 25263552, 27697999, 28670693, 28702457, 28855206, 30953364, 31372333, 31672767 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17686053, 21912642, 25526031, 28670693, 33436043, 34761615, 38598843, 39503766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	18276777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	18276777, 19139298, 29518260, 33574821, 39273501	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	22125123, 23732617, 26216880, 27894110, 29283028, 30396776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	33213069	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Facioscapulohumeral	Facioscapulohumeral muscular dystrophy	Pubtator	35621301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	22704519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	28801669		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	19020538, 22889515, 25608238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	22710983, 22889515, 24410667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	25608238	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	18206727, 25461253, 28637665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	17245764, 24858801, 25393253, 27693387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelokathexis	Myelokathexis	BEFREE	15026312, 16899028, 20592249, 23935208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	15533859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	15550692, 17640962, 17910919, 18577527, 19653123, 19821058, 20016947, 20133817, 21910857, 24751515, 25889213, 27463607, 28154007, 28650670, 28716707 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	GWASDB_DG	21211798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	27463607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	16168287	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	22044645		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	22044645, 29396305	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	Pubtator	34796122	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	36398072	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	35612662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	37731487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonia Fluctuans (disorder)	Myotonia Fluctuans	BEFREE	28903325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	26996902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	26996902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	18087217, 23987636, 26715277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	18087217, 24877105, 26715277, 33122398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	28658176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10656438, 10772680, 12239174, 12485835, 12626353, 15328206, 15540205, 15882617, 15955592, 15978329, 15987445, 16288036, 16764701, 16823836, 16977794 View all (174 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	19826912, 22311941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	CTD_human_DG	30818366		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
nervous system disorder	Nervous System Disorder	BEFREE	17560067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	17898317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	14995074, 18292939, 21906874, 22916293, 24399074, 25955316, 29259008, 30149659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	20180883, 22916293, 24452472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	26934559, 27424984, 28186979, 30182340		★★★★★ ★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	29455242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	29455242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	17875698, 20554030, 29020982, 29455242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	23434321, 28055968, 29020982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	29310647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	30809033, 31700087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	31700087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	17548653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12626353, 18575756, 20147779, 20378003, 21292343, 21514686, 24025971, 25609202, 25797207, 26338423, 28721072, 29032612, 29721166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nongerminomatous Germ Cell Tumor	Nongerminomatous Tumor	BEFREE	26453693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	15026622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28687617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30764545, 33487124, 35894174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	37006170	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal syndrome	Pubtator	37082886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	21592819, 22699677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Nerve Glioma	Optic Nerve Glioma	BEFREE	17875698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	11817585	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	27356492, 30664157, 30942441, 34183035	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30737274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31543513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	15701832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	20806347, 21631268, 22173290, 26546437, 36519392, 37537613, 38315381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24002596, 24040160, 28038429, 28632184, 29735547, 29845707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	21296802, 28478265		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15921680, 22025564, 22241961, 23372646, 23615713, 24762228, 25320277, 26103953, 28413458, 28753202, 30181917, 30191987, 30802149, 30822630		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15921680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21527066, 21711548, 22025564, 22415233, 22549810, 24376747, 24408020, 25712684, 28852723, 37966614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10999740, 20462600, 22450749, 23672538, 23740244, 24033967, 24594697, 25605248, 26044561, 27542220, 28336327, 29434873, 30337520, 31275385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26976451, 28581520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	17379424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17560257, 19002187, 19035451, 21045835, 22450749, 22472349, 22995914, 23740244, 24068191, 24175834, 25407240, 32463297, 35119076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21448932	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	35068863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	18089812, 23918302, 26847706, 28272462, 29316404, 30832753, 31814850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	19551455, 30428473, 31535659, 31831012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	BEFREE	22044645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	35921900, 35958564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	16045736, 27580404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	16045736, 26821679	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	21382035, 27580404, 30737274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	26821679	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	35491409, 36793719, 39610070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	21403096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	21403096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	31070930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	29475239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	20483910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	24980553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	20309720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	18698020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	18698020, 23895705	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	31186083	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	31186083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	15019705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	10803521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	10803521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	17914737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	25072364, 30453100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	18322253, 26058075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	21296802, 28478265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	16944452, 31505255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	29414663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	23570798, 25433721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	18206727, 18511598, 20858855, 25461253, 28637665, 28903325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	LHGDN	18206727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	19381432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	29246578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15328206, 15467730, 15816537, 16005185, 16114056, 17034033, 17785557, 18337451, 18452560, 18836306, 19064579, 21281819, 21607288, 22074556, 22245379 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	32542667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	11912162, 12761880, 15328206, 15467730, 15844659, 16114056, 17034033, 17785557, 18337451, 18563594		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12761880, 15467730, 15816537, 16756721, 16859559, 17034033, 18057003, 18337451, 18452560, 18836306, 19460858, 21430300, 21470957, 22074556, 22245379 View all (7 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17785557		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21281819	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	22245379		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	26296527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	26296527	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	31424569, 38003437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	31116013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	24114538, 31714404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	19628780, 33816621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	33116473, 38569426, 39819718	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	15286810, 19433312, 23710557, 28179498, 28979687, 29499695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyelonephritis	Pyelonephritis	BEFREE	30905425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	20177796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	LHGDN	17143542, 17982648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	11953881, 24991762, 27212031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17083723, 19796655, 24032722, 24943683, 28279221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	24637920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	BEFREE	20889568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	19381432, 29310647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	27832196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis	Retinitis	BEFREE	21396623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	12239174, 20068066, 26037167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	LHGDN	12239174, 17768666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	12239174, 20068066, 26037167	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11086103, 11817585, 12096225, 16507142, 17320408, 17393416, 17530707, 20609598, 20617529, 21753787, 21953583, 22386691, 23710557, 24516346, 24574213 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15641073, 17393416, 17530707, 17949547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	33836777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	31173066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	31116013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	35839307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	12907452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	37909603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	24101523		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	24578173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SCLEROSING CHOLANGITIS, NEONATAL	Sclerosing Cholangitis	BEFREE	20019191		★★★★★ ★☆☆☆☆ Found in Text Mining only
SEBASTIAN SYNDROME	SEBASTIAN SYNDROME	BEFREE	21833445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	27503580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	23495012, 30315637, 31412792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	31412792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	17075377, 28562124, 30489503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	20201651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	16204308, 31106661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	30518812	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	30336792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	Pubtator	26996902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	11710719, 15986367, 18354239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	26296527	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	14603250, 19455144, 20147779, 25504108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spherocytosis Type 1	Spherocytosis	Pubtator	37922232	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	12096225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	20109227, 22220212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15201990, 18487224, 18781098, 19671192, 22847686, 25422203, 26296527, 30874597, 31423170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17634424, 18310089, 18386165, 18448428, 18487224, 19082444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26577115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18781098, 26232325, 28475003, 31304688, 35211756, 36300800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22384257	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25866764	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	18781098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	30519048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	15363550, 21380786, 25474514, 25866764, 26374452, 29061496, 31304688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	18487224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	30385376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	22044645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18453750, 21482691, 21633638, 21960286, 22806902, 23258739, 24929539, 25220301, 27147244, 28281844, 28533662, 28544785, 31273931, 31650323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17653799, 18949410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19688824, 20032431, 21633638, 21880153, 22337890, 24929539, 25220301, 25400739, 27716367, 28533662, 31273931, 32881844, 33110054, 33495829, 34957697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20386750	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20529313	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	36315566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	21584490		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	29456663, 30431073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	16948134, 18930992, 22311941		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	18632989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Telangiectasia Hereditary Hemorrhagic	Hereditary hemorrhagic telangiectasia	Pubtator	24587130, 34906163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	24894780	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	19006565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	19006565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	20009035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	27463607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	29112684	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	23918302, 27082011, 28272462, 30832753, 30872410, 35786050, 38073379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	21752897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	LHGDN	15699497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	11443213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	27082011, 35786050, 36419107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	19646633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	18436740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29926386, 31190884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36341391	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11095335, 19774645, 20865359, 24687413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23526079, 24291546, 32228629, 32579540, 33204728, 38001512, 40447619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34517533	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	22958742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	16977794, 19788587, 19808652, 22958742, 25422203, 25940978, 26191295, 28074045, 35083551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	28010141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	20036848, 23164171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	24052640, 26490988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	19059114, 20889568, 29233725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	25055351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	24102302	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	28132854		★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	28132854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	29246578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	17070589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	18448868, 19394082, 25371371, 26878134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	LHGDN	18448868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	18448868, 25371371, 27301862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
WHIM syndrome	Whim syndrome	Pubtator	15026312, 15536153, 15781337, 18436740, 18556651, 19956569, 21890643, 23734232, 34807749, 35588454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	LHGDN	12135674		★★★★★ ★☆☆☆☆ Found in Text Mining only

CXCL12 (C-X-C motif chemokine ligand 12)