Gene Gene information from NCBI Gene database.
Entrez ID 6385
Gene name Syndecan 4
Gene symbol SDC4
Synonyms (NCBI Gene)
SYND4
Chromosome 20
Chromosome location 20q13.12
Summary The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan that functions as a receptor in intracellular signaling. The encoded protein is found as a homodimer and is a member of the syndecan proteoglycan family. This gene i
miRNA miRNA information provided by mirtarbase database.
1116
miRTarBase ID miRNA Experiments Reference
MIRT002795 hsa-miR-1-3p Microarray 15685193
MIRT022356 hsa-miR-124-3p Microarray 18668037
MIRT002795 hsa-miR-1-3p Proteomics;Microarray 18668037
MIRT002795 hsa-miR-1-3p Microarray 15685193
MIRT438457 hsa-miR-18a-5p Luciferase reporter assayqRT-PCR 25089138
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
POU2F1 Unknown 19212692
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
28
GO ID Ontology Definition Evidence Reference
GO:0001657 Process Ureteric bud development IEA
GO:0001843 Process Neural tube closure IEA
GO:0001968 Function Fibronectin binding IEA
GO:0005080 Function Protein kinase C binding IEA
GO:0005515 Function Protein binding IPI 12571249, 18093920, 19350579, 25416956, 30282023, 32296183, 33961781, 34069441
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600017 10661 ENSG00000124145
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P31431
Protein name Syndecan-4 (SYND4) (Amphiglycan) (Ryudocan core protein)
Protein function Cell surface proteoglycan which regulates exosome biogenesis in concert with SDCBP and PDCD6IP (PubMed:22660413).
PDB 1EJP , 1EJQ , 1OBY , 1YBO , 8BLV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01034 Syndecan 139 196 Syndecan domain Family
Tissue specificity TISSUE SPECIFICITY: Detected in fibroblasts (at protein level) (PubMed:1500433, PubMed:36213313). Also expressed in epithelial cells (PubMed:1500433). {ECO:0000269|PubMed:1500433, ECO:0000269|PubMed:36213313}.
Sequence
MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFEL
SGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVE
ESEDVSNKVSMSSTVQGSNIFERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSY
DLGKKPIYKKAPTNEF
YA
Sequence length 198
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  ECM-receptor interaction
Cell adhesion molecules
Cytoskeleton in muscle cells
Proteoglycans in cancer
Fluid shear stress and atherosclerosis
  A tetrasaccharide linker sequence is required for GAG synthesis
HS-GAG biosynthesis
HS-GAG degradation
Cell surface interactions at the vascular wall
Syndecan interactions
Defective B4GALT7 causes EDS, progeroid type
Defective B3GAT3 causes JDSSDHD
Defective EXT2 causes exostoses 2
Defective EXT1 causes exostoses 1, TRPS2 and CHDS
Defective B3GALT6 causes EDSP2 and SEMDJL1
Retinoid metabolism and transport
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CARCINOMA, NON-SMALL-CELL LUNG CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
PSORIASIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 30718543 Stimulate
★☆☆☆☆
Found in Text Mining only
Aortic Valve Stenosis Aortic Valve Sclerosis BEFREE 22164265, 29248646
★☆☆☆☆
Found in Text Mining only
Arteriosclerosis Arteriosclerosis BEFREE 26221595
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis BEFREE 30053064
★☆☆☆☆
Found in Text Mining only
Asthma Asthma BEFREE 22268118
★☆☆☆☆
Found in Text Mining only
Asthma Asthma Pubtator 22268118 Associate
★☆☆☆☆
Found in Text Mining only
Astrocytoma Astrocytoma BEFREE 29157673
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis BEFREE 26221595
★☆☆☆☆
Found in Text Mining only
Atrial Fibrillation Atrial fibrillation Pubtator 36341343 Associate
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorders Autism Spectrum Disorder BEFREE 31743624
★☆☆☆☆
Found in Text Mining only