SRR (serine racemase)

Gene

• Entrez ID: 63826
• Gene name: Serine racemase
• Gene symbol: SRR
• Synonyms (NCBI Gene): ILV1, ISO1
• Chromosome: 17
• Chromosome location: 17p13.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT731604	hsa-miR-193a-5p	Luciferase reporter assay	26913720
MIRT731604	hsa-miR-193a-5p	Luciferase reporter assay	26913720
MIRT731604	hsa-miR-193a-5p	Luciferase reporter assay	26913720
MIRT731604	hsa-miR-193a-5p	Luciferase reporter assay	26913720
MIRT731604	hsa-miR-193a-5p	Luciferase reporter assay	26913720
MIRT2116742	hsa-miR-3646	CLIP-seq
MIRT2339171	hsa-miR-561	CLIP-seq
MIRT2632951	hsa-miR-1207-5p	CLIP-seq
MIRT2632952	hsa-miR-1587	CLIP-seq
MIRT2632953	hsa-miR-2964a-5p	CLIP-seq
MIRT2632954	hsa-miR-3121-3p	CLIP-seq
MIRT2632955	hsa-miR-3155	CLIP-seq
MIRT2632956	hsa-miR-3155b	CLIP-seq
MIRT2632957	hsa-miR-3607-3p	CLIP-seq
MIRT2632958	hsa-miR-4265	CLIP-seq
MIRT2632959	hsa-miR-4273	CLIP-seq
MIRT2632960	hsa-miR-4282	CLIP-seq
MIRT2632961	hsa-miR-4296	CLIP-seq
MIRT2632962	hsa-miR-4322	CLIP-seq
MIRT2632963	hsa-miR-4330	CLIP-seq
MIRT2632964	hsa-miR-4417	CLIP-seq
MIRT2632965	hsa-miR-4436b-3p	CLIP-seq
MIRT2632966	hsa-miR-4502	CLIP-seq
MIRT2632967	hsa-miR-4674	CLIP-seq
MIRT2632968	hsa-miR-4677-5p	CLIP-seq
MIRT2632969	hsa-miR-4761-3p	CLIP-seq
MIRT2632970	hsa-miR-4762-3p	CLIP-seq
MIRT2632971	hsa-miR-4763-3p	CLIP-seq
MIRT2632972	hsa-miR-4775	CLIP-seq
MIRT2632973	hsa-miR-484	CLIP-seq
MIRT2632974	hsa-miR-511	CLIP-seq
MIRT2632975	hsa-miR-582-5p	CLIP-seq
MIRT2632976	hsa-miR-595	CLIP-seq
MIRT2632977	hsa-miR-600	CLIP-seq
MIRT2632978	hsa-miR-624	CLIP-seq
MIRT2632951	hsa-miR-1207-5p	CLIP-seq
MIRT2632952	hsa-miR-1587	CLIP-seq
MIRT2692015	hsa-miR-2355-3p	CLIP-seq
MIRT2632954	hsa-miR-3121-3p	CLIP-seq
MIRT2692016	hsa-miR-3140-3p	CLIP-seq
MIRT2632955	hsa-miR-3155	CLIP-seq
MIRT2632956	hsa-miR-3155b	CLIP-seq
MIRT2632957	hsa-miR-3607-3p	CLIP-seq
MIRT2632958	hsa-miR-4265	CLIP-seq
MIRT2632959	hsa-miR-4273	CLIP-seq
MIRT2632960	hsa-miR-4282	CLIP-seq
MIRT2632961	hsa-miR-4296	CLIP-seq
MIRT2632962	hsa-miR-4322	CLIP-seq
MIRT2632963	hsa-miR-4330	CLIP-seq
MIRT2632964	hsa-miR-4417	CLIP-seq
MIRT2632965	hsa-miR-4436b-3p	CLIP-seq
MIRT2692017	hsa-miR-4646-3p	CLIP-seq
MIRT2632967	hsa-miR-4674	CLIP-seq
MIRT2632968	hsa-miR-4677-5p	CLIP-seq
MIRT2632969	hsa-miR-4761-3p	CLIP-seq
MIRT2632971	hsa-miR-4763-3p	CLIP-seq
MIRT2632972	hsa-miR-4775	CLIP-seq
MIRT2632973	hsa-miR-484	CLIP-seq
MIRT2632975	hsa-miR-582-5p	CLIP-seq
MIRT2632976	hsa-miR-595	CLIP-seq
MIRT2632977	hsa-miR-600	CLIP-seq
MIRT2632978	hsa-miR-624	CLIP-seq
MIRT2692018	hsa-miR-676	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOS	Activation	15681805

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IBA
GO:0000287	Function	Magnesium ion binding	IDA	20106978
GO:0000287	Function	Magnesium ion binding	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0003941	Function	L-serine ammonia-lyase activity	IBA
GO:0003941	Function	L-serine ammonia-lyase activity	IDA	18812225
GO:0003941	Function	L-serine ammonia-lyase activity	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	ISS
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005524	Function	ATP binding	IBA
GO:0005524	Function	ATP binding	IDA	20106978
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16314870
GO:0005829	Component	Cytosol	TAS
GO:0006520	Process	Amino acid metabolic process	IEA
GO:0006563	Process	L-serine metabolic process	IDA	11054547, 15193426, 20106978
GO:0006563	Process	L-serine metabolic process	IEA
GO:0006563	Process	L-serine metabolic process	IEA
GO:0008721	Function	D-serine ammonia-lyase activity	IEA
GO:0009069	Process	Serine family amino acid metabolic process	ISS
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0016594	Function	Glycine binding	IEA
GO:0016594	Function	Glycine binding	ISS
GO:0016829	Function	Lyase activity	IEA
GO:0016853	Function	Isomerase activity	IEA
GO:0018114	Function	Threonine racemase activity	IEA
GO:0018114	Function	Threonine racemase activity	ISS
GO:0030165	Function	PDZ domain binding	IPI	16314870
GO:0030170	Function	Pyridoxal phosphate binding	IBA
GO:0030170	Function	Pyridoxal phosphate binding	IDA	20106978
GO:0030170	Function	Pyridoxal phosphate binding	IEA
GO:0030170	Function	Pyridoxal phosphate binding	ISS
GO:0030378	Function	Serine racemase activity	IBA
GO:0030378	Function	Serine racemase activity	IDA	11054547, 15193426, 20106978, 23391306, 29277459
GO:0030378	Function	Serine racemase activity	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEP	15681805
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	15681805, 32296183
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	20106978
GO:0042866	Process	Pyruvate biosynthetic process	IDA	18812225
GO:0043025	Component	Neuronal cell body	IDA	17880399
GO:0045177	Component	Apical part of cell	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070178	Process	D-serine metabolic process	IDA	20106978
GO:0070178	Process	D-serine metabolic process	IEA
GO:0070179	Process	D-serine biosynthetic process	IBA
GO:0070179	Process	D-serine biosynthetic process	IDA	11054547, 15193426
GO:0070179	Process	D-serine biosynthetic process	IEA
GO:1901986	Process	Response to ketamine	IEA

Other IDs

• MIM: 606477
• HGNC: 14398
• e!Ensembl: ENSG00000167720

Protein

• UniProt ID: Q9GZT4
• Protein name: Serine racemase (EC 5.1.1.18) (D-serine ammonia-lyase) (D-serine dehydratase) (EC 4.3.1.18) (L-serine ammonia-lyase) (L-serine dehydratase) (EC 4.3.1.17)
• Protein function: Catalyzes the synthesis of D-serine from L-serine (PubMed:20106978, PubMed:23391306, PubMed:29277459). D-serine is a key coagonist with glutamate at NMDA receptors. Has dehydratase activity towards both L-serine and D-serine (By similarity). {EC
• PDB: 3L6B, 3L6R, 5X2L, 6SLH, 6ZSP, 6ZUJ, 7NBC, 7NBD, 7NBF, 7NBG, 7NBH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00291	PALP	19 → 314	Pyridoxal-phosphate dependent enzyme	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the cerebellum, hippocampus, dorsolateral prefrontal cortex, and in motor neurons and glial cells of the lumbar spinal cord (at protein level) (PubMed:17880399, PubMed:24138986). Increased in the dorsolateral prefrontal co
• Sequence:

  MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGA
  LNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQA
  YGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDAL
  VVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGV
  KSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQT
  VSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV

• Sequence length: 340

Pathways

KEGG:

Glycine, serine and threonine metabolism
D-Amino acid metabolism
Metabolic pathways

Reactome:

Serine biosynthesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	27602772		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	17762863, 22117694		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	27333120		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	27333120		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	31708110		★☆☆☆☆ Found in Text Mining only
Ataxia with vitamin E deficiency	Friedreich Ataxia	BEFREE	8429255		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30692100, 31836680		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31558772		★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	28540026		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	26752192		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30555832		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	29566294		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20174558		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	22096510	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20174558, 29913163		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20174558, 37952608	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26168825, 35046895	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	20174558		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	20174558, 21647700, 23300278		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21933224, 23018631, 26168825, 29338921		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29304076, 29913163		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	29566294		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	22649515		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	29363864		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	31715145		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28327434		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	21106847		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	21767287		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30567353		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30555832		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	35996309	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	24569872		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30918891		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30622028		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	27872094		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30692100, 31836680		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31558772		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31523920		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30555832		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	22801410		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	29338921		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23273915, 31523920, 31715145, 31836680		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26913720		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31558772		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	30622028		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	31621607	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	29025687		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31523920		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	BEFREE	29084983		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15953485, 16314870, 17067558, 19483194, 22801410, 23729812, 26954593, 29168271, 30391323, 30555832, 30787885, 31515952		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	15953485, 17067558, 19483194, 22801410		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	16837850, 17880399		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	23974872, 25056061, 26198764, 28540026, 30285260, 31268507		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASDB_DG	23974872		★★☆☆☆ Found in Text Mining + Unknown/Other Associations