BIK (BCL2 interacting killer)

Gene

• Entrez ID: 638
• Gene name: BCL2 interacting killer
• Gene symbol: BIK
• Synonyms (NCBI Gene): BIP1, BP4, NBK
• Chromosome: 22
• Chromosome location: 22q13.2
• Summary: The protein encoded by this gene shares a critical BH3 domain with other death-promoting proteins, such as BID, BAK, BAD and BAX, that is required for its pro-apoptotic activity, and for interaction with anti-apoptotic members of the BCL2 family, and vira

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019109	hsa-miR-335-5p	Microarray	18185580
MIRT019414	hsa-miR-148b-3p	Microarray	17612493
MIRT021409	hsa-miR-9-5p	Microarray	17612493
MIRT821491	hsa-miR-1236	CLIP-seq
MIRT821492	hsa-miR-1257	CLIP-seq
MIRT821493	hsa-miR-1285	CLIP-seq
MIRT821494	hsa-miR-1343	CLIP-seq
MIRT821495	hsa-miR-3187-5p	CLIP-seq
MIRT821496	hsa-miR-4790-3p	CLIP-seq
MIRT821497	hsa-miR-612	CLIP-seq
MIRT821498	hsa-miR-760	CLIP-seq
MIRT1942852	hsa-miR-539	CLIP-seq
MIRT1942853	hsa-miR-570	CLIP-seq
MIRT821491	hsa-miR-1236	CLIP-seq
MIRT821492	hsa-miR-1257	CLIP-seq
MIRT821493	hsa-miR-1285	CLIP-seq
MIRT821494	hsa-miR-1343	CLIP-seq
MIRT2181602	hsa-miR-1972	CLIP-seq
MIRT821495	hsa-miR-3187-5p	CLIP-seq
MIRT2181603	hsa-miR-377	CLIP-seq
MIRT2181604	hsa-miR-4455	CLIP-seq
MIRT2181605	hsa-miR-4717-5p	CLIP-seq
MIRT821496	hsa-miR-4790-3p	CLIP-seq
MIRT1942852	hsa-miR-539	CLIP-seq
MIRT1942853	hsa-miR-570	CLIP-seq
MIRT821497	hsa-miR-612	CLIP-seq
MIRT2181606	hsa-miR-634	CLIP-seq
MIRT821498	hsa-miR-760	CLIP-seq
MIRT2384778	hsa-miR-1207-5p	CLIP-seq
MIRT821492	hsa-miR-1257	CLIP-seq
MIRT2384779	hsa-miR-1909	CLIP-seq
MIRT2384780	hsa-miR-4433	CLIP-seq
MIRT2384781	hsa-miR-4688	CLIP-seq
MIRT2384782	hsa-miR-4722-5p	CLIP-seq
MIRT2384783	hsa-miR-4763-3p	CLIP-seq
MIRT821496	hsa-miR-4790-3p	CLIP-seq
MIRT2384784	hsa-miR-486-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	9027312, 9463381, 15694340, 16189514, 16697956, 17289999, 18953687, 20010695, 21516116, 23235460, 23563182, 25416956, 26871637, 27107012, 31515488, 32296183, 33961781
GO:0005739	Component	Mitochondrion	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	10381623
GO:0008584	Process	Male gonad development	IBA
GO:0008637	Process	Apoptotic mitochondrial changes	IBA
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IEA
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	21041309
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0042981	Process	Regulation of apoptotic process	IDA	16697956
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	IDA	21041309
GO:0097136	Component	Bcl-2 family protein complex	IPI	15694340

Other IDs

• MIM: 603392
• HGNC: 1051
• e!Ensembl: ENSG00000100290

Protein

• UniProt ID: Q13323
• Protein name: Bcl-2-interacting killer (Apoptosis inducer NBK) (BIP1) (BP4)
• Protein function: Accelerates programmed cell death. Association to the apoptosis repressors Bcl-X(L), BHRF1, Bcl-2 or its adenovirus homolog E1B 19k protein suppresses this death-promoting activity. Does not interact with BAX.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12201	bcl-2I13	1 → 159	Bcl2-interacting killer, BH3-domain containing	Domain

• Sequence:

  MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALR
  LACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMR
  FWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK

• Sequence length: 160

Pathways

KEGG:

Endocrine resistance

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATAXIA TELANGIECTASIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog, GenCC GWAS catalog, GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	24788683		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26423071		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	18805830	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31717752		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	19898928		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	31717752		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	18805830	Inhibit	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	31624239	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	18805830	Inhibit	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	25143601, 26620891	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	18805830, 31270155	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	12874789, 21622563, 28368239		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	12874789		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	22288719		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17047080, 17440086, 21622563, 22855140, 26662110, 27120789, 27845892		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	14983013, 16060964, 17440086, 21622563, 24100375, 25966904, 26662110, 27120789, 27845892, 28287102, 31635499, 32116328, 32528057, 33678323	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10500065	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	32116328	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	32116328	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	32116328	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12874789		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	18805830	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30584337		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17109495	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25548100, 28796811	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	18805830	Inhibit	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16322756		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	12874789		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	31419013	Associate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	21622563	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	22873408		★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	32528057	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32528057	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	17109495	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	18805830	Stimulate	★☆☆☆☆ Found in Text Mining only
Language Disorders	Language development disorders	Pubtator	18805830	Stimulate	★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning disorders	Pubtator	18805830	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12874789		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	12874789		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	12952595		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	25165875		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17047080, 17440086, 21622563, 22855140, 26662110, 27120789, 27845892		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30176890		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12467227, 17194181, 19641504, 19898928		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14983013, 17047080		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16060964, 26423071		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	12874789, 25165875		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28720543		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	31717752		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	28796811	Stimulate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	18805830	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19196658, 22288719		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	21063407	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	27902785		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	27902785	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	25721555		★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	12226751		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16060964, 17440086, 19641504		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	18836921		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25234362	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35008922	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30176890		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30176890	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19632297		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	26620891	Associate	★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	18805830	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18566236	Associate	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	28056055		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	22300941	Stimulate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24637719, 37093683	Associate	★☆☆☆☆ Found in Text Mining only