CX3CL1 (C-X3-C motif chemokine ligand 1)

Gene

• Entrez ID: 6376
• Gene name: C-X3-C motif chemokine ligand 1
• Gene symbol: CX3CL1
• Synonyms (NCBI Gene): ABCD-3, C3Xkine, CXC3, CXC3C, NTN, NTT, SCYD1, fractalkine, neurotactin
• Chromosome: 16
• Chromosome location: 16q21
• Summary: This gene belongs to the CX3C subgroup of chemokines, characterized by the number of amino acids located between the conserved cysteine residues. This is the only member of the CX3C subgroup, which contains three amino acids between cysteine residues, res

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT725028	hsa-miR-605-5p	HITS-CLIP	19536157
MIRT725027	hsa-miR-2681-3p	HITS-CLIP	19536157
MIRT725026	hsa-miR-3688-3p	HITS-CLIP	19536157
MIRT725025	hsa-miR-490-5p	HITS-CLIP	19536157
MIRT725024	hsa-miR-4308	HITS-CLIP	19536157
MIRT725023	hsa-miR-4292	HITS-CLIP	19536157
MIRT725022	hsa-miR-6791-5p	HITS-CLIP	19536157
MIRT725021	hsa-miR-7152-3p	HITS-CLIP	19536157
MIRT725020	hsa-miR-5093	HITS-CLIP	19536157
MIRT725028	hsa-miR-605-5p	HITS-CLIP	19536157
MIRT725027	hsa-miR-2681-3p	HITS-CLIP	19536157
MIRT725026	hsa-miR-3688-3p	HITS-CLIP	19536157
MIRT725025	hsa-miR-490-5p	HITS-CLIP	19536157
MIRT725024	hsa-miR-4308	HITS-CLIP	19536157
MIRT725023	hsa-miR-4292	HITS-CLIP	19536157
MIRT725022	hsa-miR-6791-5p	HITS-CLIP	19536157
MIRT725021	hsa-miR-7152-3p	HITS-CLIP	19536157
MIRT725020	hsa-miR-5093	HITS-CLIP	19536157
MIRT917501	hsa-miR-1185	CLIP-seq
MIRT917502	hsa-miR-1262	CLIP-seq
MIRT917503	hsa-miR-1264	CLIP-seq
MIRT917504	hsa-miR-1293	CLIP-seq
MIRT917505	hsa-miR-1343	CLIP-seq
MIRT917506	hsa-miR-2110	CLIP-seq
MIRT917507	hsa-miR-214	CLIP-seq
MIRT917508	hsa-miR-27a	CLIP-seq
MIRT917509	hsa-miR-27b	CLIP-seq
MIRT917510	hsa-miR-3124-3p	CLIP-seq
MIRT917511	hsa-miR-3176	CLIP-seq
MIRT917512	hsa-miR-3189-3p	CLIP-seq
MIRT917513	hsa-miR-3605-5p	CLIP-seq
MIRT917514	hsa-miR-3613-3p	CLIP-seq
MIRT917515	hsa-miR-3614-3p	CLIP-seq
MIRT917516	hsa-miR-3616-3p	CLIP-seq
MIRT917517	hsa-miR-3619-5p	CLIP-seq
MIRT917518	hsa-miR-3679-5p	CLIP-seq
MIRT917519	hsa-miR-3685	CLIP-seq
MIRT917520	hsa-miR-384	CLIP-seq
MIRT917521	hsa-miR-3919	CLIP-seq
MIRT917522	hsa-miR-3922-3p	CLIP-seq
MIRT917523	hsa-miR-3925-5p	CLIP-seq
MIRT917524	hsa-miR-4271	CLIP-seq
MIRT917525	hsa-miR-4291	CLIP-seq
MIRT917526	hsa-miR-432	CLIP-seq
MIRT917527	hsa-miR-4436b-3p	CLIP-seq
MIRT917528	hsa-miR-4443	CLIP-seq
MIRT917529	hsa-miR-4447	CLIP-seq
MIRT917530	hsa-miR-4472	CLIP-seq
MIRT917531	hsa-miR-4483	CLIP-seq
MIRT917532	hsa-miR-4651	CLIP-seq
MIRT917533	hsa-miR-4667-5p	CLIP-seq
MIRT917534	hsa-miR-4700-5p	CLIP-seq
MIRT917535	hsa-miR-4701-3p	CLIP-seq
MIRT917536	hsa-miR-4725-3p	CLIP-seq
MIRT917537	hsa-miR-4757-5p	CLIP-seq
MIRT917538	hsa-miR-4773	CLIP-seq
MIRT917539	hsa-miR-483-5p	CLIP-seq
MIRT917540	hsa-miR-513a-5p	CLIP-seq
MIRT917541	hsa-miR-542-5p	CLIP-seq
MIRT917542	hsa-miR-548al	CLIP-seq
MIRT917543	hsa-miR-608	CLIP-seq
MIRT917544	hsa-miR-761	CLIP-seq
MIRT917545	hsa-miR-922	CLIP-seq
MIRT917502	hsa-miR-1262	CLIP-seq
MIRT917504	hsa-miR-1293	CLIP-seq
MIRT917512	hsa-miR-3189-3p	CLIP-seq
MIRT917529	hsa-miR-4447	CLIP-seq
MIRT917530	hsa-miR-4472	CLIP-seq
MIRT917531	hsa-miR-4483	CLIP-seq
MIRT917532	hsa-miR-4651	CLIP-seq
MIRT917535	hsa-miR-4701-3p	CLIP-seq
MIRT917543	hsa-miR-608	CLIP-seq
MIRT1972050	hsa-miR-1182	CLIP-seq
MIRT1972051	hsa-miR-1207-5p	CLIP-seq
MIRT1972052	hsa-miR-1233	CLIP-seq
MIRT1972053	hsa-miR-1972	CLIP-seq
MIRT917512	hsa-miR-3189-3p	CLIP-seq
MIRT917527	hsa-miR-4436b-3p	CLIP-seq
MIRT1972054	hsa-miR-4488	CLIP-seq
MIRT1972055	hsa-miR-4687-5p	CLIP-seq
MIRT1972056	hsa-miR-4697-5p	CLIP-seq
MIRT1972057	hsa-miR-4763-3p	CLIP-seq
MIRT1972050	hsa-miR-1182	CLIP-seq
MIRT2207770	hsa-miR-1183	CLIP-seq
MIRT917501	hsa-miR-1185	CLIP-seq
MIRT2207771	hsa-miR-1206	CLIP-seq
MIRT1972051	hsa-miR-1207-5p	CLIP-seq
MIRT2207772	hsa-miR-1224-3p	CLIP-seq
MIRT2207773	hsa-miR-1226	CLIP-seq
MIRT2207774	hsa-miR-125a-5p	CLIP-seq
MIRT2207775	hsa-miR-125b	CLIP-seq
MIRT2207776	hsa-miR-1260	CLIP-seq
MIRT2207777	hsa-miR-1260b	CLIP-seq
MIRT917502	hsa-miR-1262	CLIP-seq
MIRT2207778	hsa-miR-1273f	CLIP-seq
MIRT2207779	hsa-miR-1278	CLIP-seq
MIRT2207780	hsa-miR-1280	CLIP-seq
MIRT2207781	hsa-miR-1286	CLIP-seq
MIRT917504	hsa-miR-1293	CLIP-seq
MIRT2207782	hsa-miR-143	CLIP-seq
MIRT2207783	hsa-miR-1909	CLIP-seq
MIRT917507	hsa-miR-214	CLIP-seq
MIRT2207784	hsa-miR-2467-3p	CLIP-seq
MIRT2207785	hsa-miR-3169	CLIP-seq
MIRT917512	hsa-miR-3189-3p	CLIP-seq
MIRT2207786	hsa-miR-3194-5p	CLIP-seq
MIRT2207787	hsa-miR-342-5p	CLIP-seq
MIRT917513	hsa-miR-3605-5p	CLIP-seq
MIRT917517	hsa-miR-3619-5p	CLIP-seq
MIRT2207788	hsa-miR-3678-3p	CLIP-seq
MIRT917518	hsa-miR-3679-5p	CLIP-seq
MIRT2207789	hsa-miR-3689a-3p	CLIP-seq
MIRT2207790	hsa-miR-3689c	CLIP-seq
MIRT2207791	hsa-miR-4260	CLIP-seq
MIRT2207792	hsa-miR-4283	CLIP-seq
MIRT2207793	hsa-miR-4319	CLIP-seq
MIRT917527	hsa-miR-4436b-3p	CLIP-seq
MIRT917529	hsa-miR-4447	CLIP-seq
MIRT917530	hsa-miR-4472	CLIP-seq
MIRT917531	hsa-miR-4483	CLIP-seq
MIRT1972054	hsa-miR-4488	CLIP-seq
MIRT2207794	hsa-miR-4489	CLIP-seq
MIRT2207795	hsa-miR-4492	CLIP-seq
MIRT2207796	hsa-miR-4498	CLIP-seq
MIRT2207797	hsa-miR-4505	CLIP-seq
MIRT2207798	hsa-miR-4530	CLIP-seq
MIRT2207799	hsa-miR-4641	CLIP-seq
MIRT917532	hsa-miR-4651	CLIP-seq
MIRT2207800	hsa-miR-4661-3p	CLIP-seq
MIRT2207801	hsa-miR-4664-5p	CLIP-seq
MIRT1972056	hsa-miR-4697-5p	CLIP-seq
MIRT917535	hsa-miR-4701-3p	CLIP-seq
MIRT2207802	hsa-miR-4708-5p	CLIP-seq
MIRT2207803	hsa-miR-4728-5p	CLIP-seq
MIRT2207804	hsa-miR-4731-5p	CLIP-seq
MIRT2207805	hsa-miR-4733-3p	CLIP-seq
MIRT2207806	hsa-miR-4755-3p	CLIP-seq
MIRT1972057	hsa-miR-4763-3p	CLIP-seq
MIRT2207807	hsa-miR-4770	CLIP-seq
MIRT917539	hsa-miR-483-5p	CLIP-seq
MIRT2207808	hsa-miR-541	CLIP-seq
MIRT917541	hsa-miR-542-5p	CLIP-seq
MIRT917542	hsa-miR-548al	CLIP-seq
MIRT917543	hsa-miR-608	CLIP-seq
MIRT2207809	hsa-miR-654-5p	CLIP-seq
MIRT917544	hsa-miR-761	CLIP-seq
MIRT2207810	hsa-miR-762	CLIP-seq
MIRT917545	hsa-miR-922	CLIP-seq
MIRT917502	hsa-miR-1262	CLIP-seq
MIRT917504	hsa-miR-1293	CLIP-seq
MIRT2207784	hsa-miR-2467-3p	CLIP-seq
MIRT917512	hsa-miR-3189-3p	CLIP-seq
MIRT917527	hsa-miR-4436b-3p	CLIP-seq
MIRT917529	hsa-miR-4447	CLIP-seq
MIRT917530	hsa-miR-4472	CLIP-seq
MIRT917531	hsa-miR-4483	CLIP-seq
MIRT2207795	hsa-miR-4492	CLIP-seq
MIRT2207796	hsa-miR-4498	CLIP-seq
MIRT2207797	hsa-miR-4505	CLIP-seq
MIRT2207798	hsa-miR-4530	CLIP-seq
MIRT917532	hsa-miR-4651	CLIP-seq
MIRT917535	hsa-miR-4701-3p	CLIP-seq
MIRT917543	hsa-miR-608	CLIP-seq
MIRT2207810	hsa-miR-762	CLIP-seq
MIRT917510	hsa-miR-3124-3p	CLIP-seq
MIRT2447841	hsa-miR-4469	CLIP-seq
MIRT2447842	hsa-miR-4777-3p	CLIP-seq
MIRT2447843	hsa-miR-642a	CLIP-seq
MIRT917510	hsa-miR-3124-3p	CLIP-seq
MIRT2447841	hsa-miR-4469	CLIP-seq
MIRT2447842	hsa-miR-4777-3p	CLIP-seq
MIRT2447843	hsa-miR-642a	CLIP-seq
MIRT917510	hsa-miR-3124-3p	CLIP-seq
MIRT2447841	hsa-miR-4469	CLIP-seq
MIRT2447842	hsa-miR-4777-3p	CLIP-seq
MIRT2447843	hsa-miR-642a	CLIP-seq
MIRT917510	hsa-miR-3124-3p	CLIP-seq
MIRT2447841	hsa-miR-4469	CLIP-seq
MIRT2447842	hsa-miR-4777-3p	CLIP-seq
MIRT2447843	hsa-miR-642a	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
WT1	Unknown	17430890

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001774	Process	Microglial cell activation	ISS
GO:0001954	Process	Positive regulation of cell-matrix adhesion	TAS	24352739
GO:0002052	Process	Positive regulation of neuroblast proliferation	ISS
GO:0002523	Process	Leukocyte migration involved in inflammatory response	IMP	23125415
GO:0002931	Process	Response to ischemia	ISS
GO:0005102	Function	Signaling receptor binding	TAS	12714508
GO:0005125	Function	Cytokine activity	IEA
GO:0005178	Function	Integrin binding	IDA	23125415
GO:0005515	Function	Protein binding	IPI	9931005, 23125415, 24789099, 25745166, 27653778
GO:0005576	Component	Extracellular region	IDA	10415068, 12714508
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	IMP	10899174
GO:0005576	Component	Extracellular region	ISS
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	24352739
GO:0006935	Process	Chemotaxis	IDA	21829356
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	IMP	23125415
GO:0006952	Process	Defense response	TAS	12714508
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	12714508
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	IPI	10187784
GO:0007186	Process	G protein-coupled receptor signaling pathway	ISS
GO:0007267	Process	Cell-cell signaling	TAS	24352739
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IDA	21829356
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	IGI	10415068
GO:0008009	Function	Chemokine activity	TAS	12714508, 24352739
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	24294368
GO:0009986	Component	Cell surface	IDA	12714508
GO:0009986	Component	Cell surface	IEA
GO:0010812	Process	Negative regulation of cell-substrate adhesion	NAS	24352739
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0016020	Component	Membrane	IDA	10899174, 12714508
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016322	Process	Neuron remodeling	TAS	20920788
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS	11777952
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0030336	Process	Negative regulation of cell migration	IDA	25435433
GO:0030593	Process	Neutrophil chemotaxis	IEA
GO:0030595	Process	Leukocyte chemotaxis	TAS	11777952
GO:0031664	Process	Regulation of lipopolysaccharide-mediated signaling pathway	IDA	10652441
GO:0031737	Function	CX3C chemokine receptor binding	IDA	10415068, 23125415
GO:0031737	Function	CX3C chemokine receptor binding	IEA
GO:0031737	Function	CX3C chemokine receptor binding	NAS	20018408
GO:0031737	Function	CX3C chemokine receptor binding	TAS	24352739
GO:0032233	Process	Positive regulation of actin filament bundle assembly	IGI	10415068
GO:0032690	Process	Negative regulation of interleukin-1 alpha production	ISS
GO:0032691	Process	Negative regulation of interleukin-1 beta production	TAS	20018408
GO:0032715	Process	Negative regulation of interleukin-6 production	TAS	20018408
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	10652441
GO:0032720	Process	Negative regulation of tumor necrosis factor production	TAS	20018408
GO:0032914	Process	Positive regulation of transforming growth factor beta1 production	IEA
GO:0033622	Process	Integrin activation	IMP	23125415
GO:0035425	Process	Autocrine signaling	ISS
GO:0042056	Function	Chemoattractant activity	IMP	10899174
GO:0042060	Process	Wound healing	IEA
GO:0042995	Component	Cell projection	ISS
GO:0043005	Component	Neuron projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043025	Component	Neuronal cell body	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IMP	24294368
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IGI	10869418
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS
GO:0043410	Process	Positive regulation of MAPK cascade	IGI	10415068
GO:0044297	Component	Cell body	IEA
GO:0045237	Function	CXCR1 chemokine receptor binding	IPI	10187784
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0048020	Function	CCR chemokine receptor binding	IBA
GO:0048167	Process	Regulation of synaptic plasticity	TAS	24352739
GO:0048245	Process	Eosinophil chemotaxis	IBA
GO:0048246	Process	Macrophage chemotaxis	IEA
GO:0048247	Process	Lymphocyte chemotaxis	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	ISS
GO:0050729	Process	Positive regulation of inflammatory response	IEP	11777952
GO:0050767	Process	Regulation of neurogenesis	TAS	24352739
GO:0050902	Process	Leukocyte adhesive activation	TAS	12714508
GO:0050918	Process	Positive chemotaxis	IMP	10899174
GO:0051041	Process	Positive regulation of calcium-independent cell-cell adhesion	IDA	12714508
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IGI	10415068, 10869418
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IGI	10415068, 10869418
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0060055	Process	Angiogenesis involved in wound healing	IEA
GO:0060326	Process	Cell chemotaxis	IDA	10415068
GO:0061518	Process	Microglial cell proliferation	IMP	12125082
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0070050	Process	Neuron cellular homeostasis	ISS
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IDA	10415068
GO:0070098	Process	Chemokine-mediated signaling pathway	IGI	10869418
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	TAS	24352739
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:0098609	Process	Cell-cell adhesion	ISS
GO:0098609	Process	Cell-cell adhesion	TAS	24352739
GO:0098883	Process	Synapse pruning	TAS	20920788
GO:0110091	Process	Negative regulation of hippocampal neuron apoptotic process	IGI	10869418
GO:1900450	Process	Negative regulation of glutamate receptor signaling pathway	ISS
GO:1903979	Process	Negative regulation of microglial cell activation	ISS
GO:1904141	Process	Positive regulation of microglial cell migration	IDA	10415068
GO:2001223	Process	Negative regulation of neuron migration	TAS	24352739
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IGI	10869418
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA

Other IDs

• MIM: 601880
• HGNC: 10647
• e!Ensembl: ENSG00000006210

Protein

• UniProt ID: P78423
• Protein name: Fractalkine (C-X3-C motif chemokine 1) (CX3C membrane-anchored chemokine) (Neurotactin) (Small-inducible cytokine D1) [Cleaved into: Processed fractalkine]
• Protein function: Chemokine that acts as a ligand for both CX3CR1 and integrins ITGAV:ITGB3 and ITGA4:ITGB1 (PubMed:12055230, PubMed:21829356, PubMed:23125415, PubMed:9782118, PubMed:9931005). The CX3CR1-CX3CL1 signaling exerts distinct functions in different tis
• PDB: 1B2T, 1F2L, 3ONA, 4XT1, 4XT3, 5WB2, 7RKF, 7RKM, 7RKN, 7XBX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	31 → 89	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the seminal plasma, endometrial fluid and follicular fluid (at protein level). Small intestine, colon, testis, prostate, heart, brain, lung, skeletal muscle, kidney and pancreas. Most abundant in the brain and heart. {ECO:
• Sequence:

  MAPISLSWLLRLATFCHLTVLLAGQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGK
  RAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGG
  MDESVVLEPEATGESSSLEPTPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGP
  VGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENA
  PSEGQRVWGQGQSPRPENSLEREEMGPVPAHTDAFQDWGPGSMAHVSVVPVSSEGTPSRE
  PVASGSWTPKAEEPIHATMDPQRLGVLITPVPDAQAATRRQAVGLLAFLGLLFCLGVAMF
  TYQSLQGCPRKMAGEMAEGLRYIPRSCGSNSYVLVPV

• Sequence length: 397

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
Efferocytosis
TNF signaling pathway
Human cytomegalovirus infection

Reactome:

Chemokine receptors bind chemokines
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COMMON COLD	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COR PULMONALE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	26632602		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	29380447		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	23857671		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	10998441		★☆☆☆☆ Found in Text Mining only
Aganglionosis, Colonic	Colonic Aganglionosis	BEFREE	10946353, 11685702		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	15944936, 21126357, 24664727		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30092003, 32592865	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	28810892, 29380447		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30607245		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	24528288	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	25480631		★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	20019415, 22664781	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	25424368	Stimulate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24084767		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	29274778	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	27658415		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia nervosa	Pubtator	33498837	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	18296082, 31539405	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	LHGDN	18296082		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	LHGDN	12551893		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17456471, 19840952, 21525510, 23974513, 25845619, 28282403, 28821884, 28842393, 29641559, 30553772		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29148410		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	32884948	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11583978, 12428227, 15880821, 17471309, 17665439	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20185962	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	29148410		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	16424217, 20523302, 28859129	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	17505143, 20523302, 28677664, 28859129		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	12969992		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17456471, 19840952, 21525510, 23974513, 25845619, 28282403, 28821884, 28842393, 29641559, 30553772		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	17456471, 17591977, 19840952, 20019415, 21525510, 21873805, 24307998, 25040843, 29406386, 38256102	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	29715366		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	23162109		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	27579490		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23720051, 30310518		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29274778, 35045088, 35294039, 37040163	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32321535	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	LHGDN	16645504		★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	27509989	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19457610	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20922190, 25926643, 36938723, 39273406, 40051011	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27156946, 29380447, 30628679		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	22064656	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	29867042	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22699780	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35734169, 36397015	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21750716, 31077234		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	36936778	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	19372452		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	28677375, 33319833	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	28934294, 31652730		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	28934294	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	22072684		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	40594558	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29323156		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	37679252	Stimulate	★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	Pubtator	23765258	Associate	★☆☆☆☆ Found in Text Mining only
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress	Choreoathetosis	Pubtator	35045088	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30382361, 30978114, 31629111		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29939299		★☆☆☆☆ Found in Text Mining only
Colitis Collagenous	Collagenous colitis	Pubtator	25948880	Stimulate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35572821	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17611763, 28691930, 9085167		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	23162109		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	18585734		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	21498626		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	16224053, 26191329		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	16224053, 20523302, 25845619, 26191329		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	16224053		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	17456471, 20523302, 22664781, 25424368, 26191329	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	16224053, 26191329		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28842393		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19000946	Associate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	29433150		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	24556958, 28470428, 29268768, 31228817		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	32592865	Stimulate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	29843940, 30245615		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	37924373	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	30870525	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	26976687		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	15131578	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	28821884	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	15131578		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	24821910		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30253743		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	23956503	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30253743		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21525510	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21525510		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28178341		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	26710229		★☆☆☆☆ Found in Text Mining only
Dowling Degos Disease	Dowling degos disease	Pubtator	21356322	Stimulate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	37876509, 39884388	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	24821910		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	LHGDN	10640747		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	23517860		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	23517860, 24294368, 24427339	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21750716		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	31385574	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	30119681	Stimulate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	28747747		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24859792		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32346064, 38287522	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20511186	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30119681, 30575118		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30119681	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	24284376	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	22572859, 22892858	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	35693262	Associate	★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	25587706	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	18585734		★☆☆☆☆ Found in Text Mining only
Hematuria	Hematuria	Pubtator	22572859, 22892858	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	LHGDN	17132725		★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	21638128		★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	28751644	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	37108648	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	25926643	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	10946353, 16618617		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	18070985, 21385932	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	28655972	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30097812		★☆☆☆☆ Found in Text Mining only
Hypertension, Renovascular	Hypertension	BEFREE	29590257		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	12016106		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	21498626, 29170451, 29590257		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23956503, 24270813	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26496926, 31077234, 35186183	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	24676787		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	32922201	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	22692452		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22442063, 29939299, 31822518		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	12940913, 28842393, 30668715		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	17241867		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	17241867	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	26976687		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	22709547	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	21356322	Stimulate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30531011		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	34689723	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	33672355	Associate	★☆☆☆☆ Found in Text Mining only
Leukocytoclastic vasculitis	Leukocytoclastic Vasculitis	BEFREE	23470165		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	40613333	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30957657		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	23765258	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	33710617	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	19432809	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	19432809	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	35186183	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	30457999, 31744836		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	18772344		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27156946, 37770496	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	28912865		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15934075, 33665864	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	33708222	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	28912865		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28912865, 29414322		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	29414322		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	28912865		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	14612547, 18060687		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	25503251	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30870525		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23720051, 30310518		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27156946, 29380447, 30628679		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31077234		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29867042		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17199135		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18060687, 26718770, 30066854, 31212389		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28868113		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19923448, 20184883, 20630606, 23388733, 24799766, 25482732, 26633537, 27156946, 29446734		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	23229614		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	27658415		★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	26168217	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	30245615		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	30845779		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	25962684, 30845779		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	34761615	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	14533779, 22916723, 24175290, 26469270, 28842393, 31191554		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	14533779		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31191554	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	25596452		★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Multiple system atrophy	Pubtator	29850876	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	16224053		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	22664781	Stimulate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	37679252	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	28800592		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	22344830	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10999462, 14612547, 17611763, 22941344, 23720051, 24084767, 25435433, 28691930, 28903329, 29380447, 30066854, 30237497, 30310518, 9085167		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15953676, 17332365		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	22253825	Inhibit	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	32941527	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	21266082, 24799766, 25596843, 29361745, 31822518		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29380447		★☆☆☆☆ Found in Text Mining only
Nongranulomatous uveitis	Nongranulomatous uveitis	BEFREE	29715366		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21525510		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21525510	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30150990	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	19302240, 32884948	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	21356322	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31780870		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28903329, 30468463		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30468463	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31077234		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22064656, 26633537, 31077234	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29867042		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29274778, 29867042	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	19153557, 29274778	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	19030200	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	19153557, 23324439	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	LHGDN	19153557		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29424203		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	10998441		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	18267286, 21266082, 22747084, 29624735		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26497684	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	15730397	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	39221259	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	30948201		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	10998441		★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	23470165		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	27386819	Inhibit	★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	29843940, 30245615		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18060687, 26718770, 30066854, 31212389		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17199135		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19047106, 26496926, 27509989	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	19155311		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	17002687, 26976687		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	16584113, 35186183	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34335580	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	18772344, 30382361		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	15608300	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29203799, 30457999		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	33665864	Associate	★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	24324211		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	26710229		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	31036641		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	37603355	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10441171, 19923448, 24324211, 27484962, 27846745, 28470428, 28842393, 30231487, 30366278		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17907166		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	LHGDN	14657873		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	17982926	Associate	★☆☆☆☆ Found in Text Mining only
Roberts Syndrome	Roberts syndrome	Pubtator	33319833	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	29715366		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	24676787		★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	31667578	Stimulate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	15608300, 16584113	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	31667578	Stimulate	★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	BEFREE	28176921		★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	24324211		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	27752937		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29380447		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37082943	Associate	★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	16224053, 31409556		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29956205		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	24676787		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28868113		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24764683	Associate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	24324211		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	24324211		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	18799080		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	30457999		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	33836338	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	9085167		★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	36674940	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	22101184, 26042517, 28842393		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28285559	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	29715366		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	40508061	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	15608300	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis, Leukocytoclastic, Cutaneous	Vasculitis	BEFREE	23470165		★☆☆☆☆ Found in Text Mining only