Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6374
Gene name	C-X-C motif chemokine ligand 5
Gene symbol	CXCL5
Synonyms (NCBI Gene)	ENA-78SCYB5
Chromosome	4
Chromosome location	4q13.3
Summary	This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein co

228

Show/Hide all (228)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019453	hsa-miR-148b-3p	Microarray	17612493
MIRT025829	hsa-miR-7-5p	Microarray	19073608
MIRT707535	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT707534	hsa-miR-369-3p	HITS-CLIP	21572407
MIRT707532	hsa-miR-5692b	HITS-CLIP	21572407
MIRT707533	hsa-miR-5692c	HITS-CLIP	21572407
MIRT707531	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT707530	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT707529	hsa-miR-656-3p	HITS-CLIP	21572407
MIRT707528	hsa-miR-374a-5p	HITS-CLIP	21572407
MIRT707527	hsa-miR-374b-5p	HITS-CLIP	21572407
MIRT707526	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT659245	hsa-miR-495-3p	HITS-CLIP	23824327
MIRT659244	hsa-miR-5688	HITS-CLIP	23824327
MIRT620652	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT620651	hsa-miR-8063	HITS-CLIP	23824327
MIRT620650	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT620649	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT620648	hsa-miR-1248	HITS-CLIP	23824327
MIRT620647	hsa-miR-3655	HITS-CLIP	23824327
MIRT620646	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT620645	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT620644	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT620643	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT659243	hsa-miR-578	HITS-CLIP	23824327
MIRT620652	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT620651	hsa-miR-8063	HITS-CLIP	23824327
MIRT620650	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT620649	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT620648	hsa-miR-1248	HITS-CLIP	23824327
MIRT620647	hsa-miR-3655	HITS-CLIP	23824327
MIRT620646	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT620645	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT620644	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT620643	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT620646	hsa-miR-3124-3p	PAR-CLIP	27292025
MIRT736788	hsa-miR-588	Western blottingImmunohistochemistry (IHC)qRT-PCR	33323542
MIRT707535	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT707534	hsa-miR-369-3p	HITS-CLIP	21572407
MIRT707532	hsa-miR-5692b	HITS-CLIP	21572407
MIRT707533	hsa-miR-5692c	HITS-CLIP	21572407
MIRT707531	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT707530	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT707529	hsa-miR-656-3p	HITS-CLIP	21572407
MIRT707528	hsa-miR-374a-5p	HITS-CLIP	21572407
MIRT707527	hsa-miR-374b-5p	HITS-CLIP	21572407
MIRT707526	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT659245	hsa-miR-495-3p	HITS-CLIP	23824327
MIRT659244	hsa-miR-5688	HITS-CLIP	23824327
MIRT620652	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT620651	hsa-miR-8063	HITS-CLIP	23824327
MIRT620650	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT620649	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT620648	hsa-miR-1248	HITS-CLIP	23824327
MIRT620647	hsa-miR-3655	HITS-CLIP	23824327
MIRT620646	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT620645	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT620644	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT620643	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT659243	hsa-miR-578	HITS-CLIP	23824327
MIRT620652	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT620651	hsa-miR-8063	HITS-CLIP	23824327
MIRT620650	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT620649	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT620648	hsa-miR-1248	HITS-CLIP	23824327
MIRT620647	hsa-miR-3655	HITS-CLIP	23824327
MIRT620646	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT620645	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT620644	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT620643	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT755568	miR-145-3p	Luciferase reporter assayWestern blottingqRT-PCR	35936390
MIRT755568	miR-145-3p	Luciferase reporter assayWestern blottingqRT-PCR	35936390
MIRT918049	hsa-miR-1206	CLIP-seq
MIRT918050	hsa-miR-2053	CLIP-seq
MIRT918051	hsa-miR-21	CLIP-seq
MIRT918052	hsa-miR-23a	CLIP-seq
MIRT918053	hsa-miR-23b	CLIP-seq
MIRT918054	hsa-miR-23c	CLIP-seq
MIRT918055	hsa-miR-25	CLIP-seq
MIRT918056	hsa-miR-302f	CLIP-seq
MIRT918057	hsa-miR-32	CLIP-seq
MIRT918058	hsa-miR-330-3p	CLIP-seq
MIRT918059	hsa-miR-34a	CLIP-seq
MIRT918060	hsa-miR-34c-5p	CLIP-seq
MIRT918061	hsa-miR-361-3p	CLIP-seq
MIRT918062	hsa-miR-363	CLIP-seq
MIRT918063	hsa-miR-3646	CLIP-seq
MIRT918064	hsa-miR-367	CLIP-seq
MIRT918065	hsa-miR-3679-3p	CLIP-seq
MIRT918066	hsa-miR-4290	CLIP-seq
MIRT918067	hsa-miR-4457	CLIP-seq
MIRT918068	hsa-miR-449a	CLIP-seq
MIRT918069	hsa-miR-449b	CLIP-seq
MIRT918070	hsa-miR-4533	CLIP-seq
MIRT918071	hsa-miR-4659a-5p	CLIP-seq
MIRT918072	hsa-miR-4659b-5p	CLIP-seq
MIRT918073	hsa-miR-4747-5p	CLIP-seq
MIRT918074	hsa-miR-4753-3p	CLIP-seq
MIRT918075	hsa-miR-4766-5p	CLIP-seq
MIRT918076	hsa-miR-4768-5p	CLIP-seq
MIRT918077	hsa-miR-4776-3p	CLIP-seq
MIRT918078	hsa-miR-4778-5p	CLIP-seq
MIRT918079	hsa-miR-5096	CLIP-seq
MIRT918080	hsa-miR-513b	CLIP-seq
MIRT918081	hsa-miR-548a-5p	CLIP-seq
MIRT918082	hsa-miR-548ab	CLIP-seq
MIRT918083	hsa-miR-548ac	CLIP-seq
MIRT918084	hsa-miR-548ae	CLIP-seq
MIRT918085	hsa-miR-548aj	CLIP-seq
MIRT918086	hsa-miR-548ak	CLIP-seq
MIRT918087	hsa-miR-548am	CLIP-seq
MIRT918088	hsa-miR-548b-5p	CLIP-seq
MIRT918089	hsa-miR-548c-5p	CLIP-seq
MIRT918090	hsa-miR-548d-3p	CLIP-seq
MIRT918091	hsa-miR-548d-5p	CLIP-seq
MIRT918092	hsa-miR-548h	CLIP-seq
MIRT918093	hsa-miR-548i	CLIP-seq
MIRT918094	hsa-miR-548j	CLIP-seq
MIRT918095	hsa-miR-548n	CLIP-seq
MIRT918096	hsa-miR-548t	CLIP-seq
MIRT918097	hsa-miR-548w	CLIP-seq
MIRT918098	hsa-miR-548x	CLIP-seq
MIRT918099	hsa-miR-548y	CLIP-seq
MIRT918100	hsa-miR-548z	CLIP-seq
MIRT918101	hsa-miR-559	CLIP-seq
MIRT918102	hsa-miR-569	CLIP-seq
MIRT918103	hsa-miR-590-5p	CLIP-seq
MIRT918104	hsa-miR-597	CLIP-seq
MIRT918105	hsa-miR-656	CLIP-seq
MIRT918106	hsa-miR-670	CLIP-seq
MIRT918107	hsa-miR-92a	CLIP-seq
MIRT918108	hsa-miR-92b	CLIP-seq
MIRT1972125	hsa-miR-1224-3p	CLIP-seq
MIRT1972126	hsa-miR-1260	CLIP-seq
MIRT1972127	hsa-miR-1260b	CLIP-seq
MIRT1972128	hsa-miR-1280	CLIP-seq
MIRT1972129	hsa-miR-129-5p	CLIP-seq
MIRT1972130	hsa-miR-2052	CLIP-seq
MIRT918050	hsa-miR-2053	CLIP-seq
MIRT918055	hsa-miR-25	CLIP-seq
MIRT918056	hsa-miR-302f	CLIP-seq
MIRT918057	hsa-miR-32	CLIP-seq
MIRT918062	hsa-miR-363	CLIP-seq
MIRT918064	hsa-miR-367	CLIP-seq
MIRT1972131	hsa-miR-4307	CLIP-seq
MIRT1972132	hsa-miR-4733-3p	CLIP-seq
MIRT1972133	hsa-miR-4759	CLIP-seq
MIRT918102	hsa-miR-569	CLIP-seq
MIRT918107	hsa-miR-92a	CLIP-seq
MIRT918108	hsa-miR-92b	CLIP-seq
MIRT1972129	hsa-miR-129-5p	CLIP-seq
MIRT1972130	hsa-miR-2052	CLIP-seq
MIRT918050	hsa-miR-2053	CLIP-seq
MIRT918055	hsa-miR-25	CLIP-seq
MIRT918056	hsa-miR-302f	CLIP-seq
MIRT918057	hsa-miR-32	CLIP-seq
MIRT2207931	hsa-miR-3614-3p	CLIP-seq
MIRT918062	hsa-miR-363	CLIP-seq
MIRT918063	hsa-miR-3646	CLIP-seq
MIRT918064	hsa-miR-367	CLIP-seq
MIRT2207932	hsa-miR-4264	CLIP-seq
MIRT1972131	hsa-miR-4307	CLIP-seq
MIRT918071	hsa-miR-4659a-5p	CLIP-seq
MIRT918072	hsa-miR-4659b-5p	CLIP-seq
MIRT918075	hsa-miR-4766-5p	CLIP-seq
MIRT918077	hsa-miR-4776-3p	CLIP-seq
MIRT918078	hsa-miR-4778-5p	CLIP-seq
MIRT2207933	hsa-miR-4797-3p	CLIP-seq
MIRT918102	hsa-miR-569	CLIP-seq
MIRT918105	hsa-miR-656	CLIP-seq
MIRT918107	hsa-miR-92a	CLIP-seq
MIRT918108	hsa-miR-92b	CLIP-seq
MIRT2207934	hsa-miR-935	CLIP-seq
MIRT2511381	hsa-miR-1243	CLIP-seq
MIRT2511382	hsa-miR-1323	CLIP-seq
MIRT2511383	hsa-miR-2467-3p	CLIP-seq
MIRT2511384	hsa-miR-3120-3p	CLIP-seq
MIRT2511385	hsa-miR-3146	CLIP-seq
MIRT2511386	hsa-miR-3148	CLIP-seq
MIRT2511387	hsa-miR-3163	CLIP-seq
MIRT2511388	hsa-miR-3609	CLIP-seq
MIRT2511389	hsa-miR-3654	CLIP-seq
MIRT2511390	hsa-miR-3915	CLIP-seq
MIRT2511391	hsa-miR-3928	CLIP-seq
MIRT2511392	hsa-miR-3973	CLIP-seq
MIRT2511393	hsa-miR-4257	CLIP-seq
MIRT2511394	hsa-miR-495	CLIP-seq
MIRT2511395	hsa-miR-520g	CLIP-seq
MIRT2511396	hsa-miR-520h	CLIP-seq
MIRT2511397	hsa-miR-545	CLIP-seq
MIRT2511398	hsa-miR-548ah	CLIP-seq
MIRT2511399	hsa-miR-548o	CLIP-seq
MIRT2511400	hsa-miR-577	CLIP-seq
MIRT2511401	hsa-miR-606	CLIP-seq
MIRT2511402	hsa-miR-665	CLIP-seq
MIRT2511403	hsa-miR-875-3p	CLIP-seq
MIRT2678865	hsa-miR-1237	CLIP-seq
MIRT2511381	hsa-miR-1243	CLIP-seq
MIRT2511382	hsa-miR-1323	CLIP-seq
MIRT2511383	hsa-miR-2467-3p	CLIP-seq
MIRT2511384	hsa-miR-3120-3p	CLIP-seq
MIRT2511385	hsa-miR-3146	CLIP-seq
MIRT2511386	hsa-miR-3148	CLIP-seq
MIRT2678866	hsa-miR-3160-3p	CLIP-seq
MIRT2511387	hsa-miR-3163	CLIP-seq
MIRT2511388	hsa-miR-3609	CLIP-seq
MIRT2511389	hsa-miR-3654	CLIP-seq
MIRT2511390	hsa-miR-3915	CLIP-seq
MIRT2511391	hsa-miR-3928	CLIP-seq
MIRT2511392	hsa-miR-3973	CLIP-seq
MIRT2511393	hsa-miR-4257	CLIP-seq
MIRT2678867	hsa-miR-4470	CLIP-seq
MIRT2678868	hsa-miR-4487	CLIP-seq
MIRT2678869	hsa-miR-4663	CLIP-seq
MIRT2678870	hsa-miR-4720-3p	CLIP-seq
MIRT918075	hsa-miR-4766-5p	CLIP-seq
MIRT2511394	hsa-miR-495	CLIP-seq
MIRT2678871	hsa-miR-511	CLIP-seq
MIRT2511395	hsa-miR-520g	CLIP-seq
MIRT2511396	hsa-miR-520h	CLIP-seq
MIRT2511397	hsa-miR-545	CLIP-seq
MIRT2511398	hsa-miR-548ah	CLIP-seq
MIRT2511399	hsa-miR-548o	CLIP-seq
MIRT2678872	hsa-miR-558	CLIP-seq
MIRT2511400	hsa-miR-577	CLIP-seq
MIRT2511401	hsa-miR-606	CLIP-seq
MIRT2511402	hsa-miR-665	CLIP-seq
MIRT2511403	hsa-miR-875-3p	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
NFKB1	Unknown	11559712
RELA	Unknown	11559712
SP1	Activation	11559712
ZNF148	Unknown	11559712

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	10820279
GO:0006952	Process	Defense response	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	TAS	10820279
GO:0007267	Process	Cell-cell signaling	TAS	7929219
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	10820279
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	10463948
GO:0030593	Process	Neutrophil chemotaxis	IBA
GO:0042802	Function	Identical protein binding	IDA	24695525
GO:0045236	Function	CXCR chemokine receptor binding	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA

MIM	HGNC	e!Ensembl
600324	10642	ENSG00000163735

P42830

Protein name

C-X-C motif chemokine 5 (ENA-78(1-78)) (Epithelial-derived neutrophil-activating protein 78) (Neutrophil-activating peptide ENA-78) (Small-inducible cytokine B5) [Cleaved into: ENA-78(8-78); ENA-78(9-78)]

Protein function

Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.

PDB

2MGS , 8XWS , 8XX7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00048	IL8	47 → 106	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

Sequence

MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHP
KMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Sequence length

114

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway IL-17 signaling pathway TNF signaling pathway Pertussis Rheumatoid arthritis		Chemokine receptors bind chemokines G alpha (i) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (183)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	18769620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	18223320, 29200871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	20562917, 23204236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11502840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	18578857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	34220331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	30157273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Extrinsic allergic alveolitis	Pubtator	19535235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34440700	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	30804325		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28360038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	17321344	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	8083342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	34963488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18576313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	8083342	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12751040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	17234659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	25871636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	25871636	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	25871636, 29174692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	25871636	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	17265155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24583128, 26058729, 29545183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	23439434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	25278075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	33026667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22408746, 23045282, 23991131, 24388382, 26611766, 26910109, 31562303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18045955, 19451693, 23543442, 23991131, 30867824	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23991131	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	27501402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30696738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18765953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24268047, 25011526, 28993096, 33955820, 35038357, 36938723	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24583128, 26058729, 29545183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22114072, 24346967, 25788272, 29200871, 29526026, 29743818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	28360038, 35468838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30867824, 32788609, 36889175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24500664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	23245743, 24184689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	23245743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	33026667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	35686557	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30257367, 31667838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30257367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	22337081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	39670859	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	33627146	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	12857718, 30154415, 31269827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	21332547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31105713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	25526479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	36857861, 37563310	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	30782668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36246978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17549409, 18578857, 28356111, 29743818, 30792394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16101183, 30255816, 32390708, 34419055, 35283273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17549409, 18413816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18578857	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27848972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	26287498, 29153655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	12871498, 26287498, 29153655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	12871498	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	29153655	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	26287498, 29153655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	16776676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	17549409, 9287972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	30009831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	36045687	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17265155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	28973351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	19035625, 20157549, 29153655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19035625, 20157549, 29153655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20157549, 28943949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic Foot	BEFREE	30775384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis congenita	Pubtator	37717172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	12620496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	14967364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	37657716	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	33663574, 34269788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	35936390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	11119492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	31131239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	30157273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	29883796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	12415593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	29344240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28993096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	23245743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	23245743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19117745		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	19535235	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	24292093, 9287972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	32020185	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35042389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	22337081, 29743818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	37540227	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	27876461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19388934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17444857, 22711685, 24268047, 25462858, 29743818, 30014484, 31821689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	21332547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	33469074	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	24346967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34407043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	19155472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26503215	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33458757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	28441588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23045282, 23991131, 24388382, 26611766, 26910109, 30867824, 31562303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22114072, 24346967, 25788272, 29200871, 29526026, 29743818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21356384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18320069, 20945384, 26701088, 27500645, 29202471, 29749439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22057037, 30796034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24583128, 26058729, 29545183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17549409, 18320069, 21356384, 22114072, 24346967, 27737879, 28356111, 28943949, 29344240, 29743818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23045282, 29434831		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11406569, 29474942, 30009831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29111234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	30832584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	24453419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	29174692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	35197088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	29174692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25268740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	30704100	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31556809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	35967338	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	29381915, 31772617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	23469080	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29665837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	30314693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11502840, 18282785, 18578857, 18975380, 21356384, 22665059, 22711685, 24074379, 24346967, 27375023, 27737879, 28356111, 29036438, 29053414, 29202471 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	19535235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	12857718, 14662873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31821689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23204236, 25788272, 29200871, 29526026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	28993096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19356715, 20157549, 24695525, 30299246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis imperfecta	Pubtator	30804325	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28277189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	28277189	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21356384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	18765953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31999765, 35468838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30404567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	34764955	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34536521	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	27737879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Penile Neoplasms	Penile neoplasm	Pubtator	33458757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28467728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	35154475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
POLYCYSTIC LIPOMEMBRANOUS OSTEODYSPLASIA WITH SCLEROSING LEUKOENCEPHALOPATHY 1	Polycystic Lipomembranous Osteodysplasia With Sclerosing Leukoencephalopathy	BEFREE	30690291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18320069, 20945384, 26701088, 27500645, 29202471, 29749439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic disease	Pubtator	18320069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	18320069, 29202471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18320069, 37698493	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31636124, 36524848, 37922327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29111234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	33416099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Cystic Fibrosis	Pulmonary Cystic Fibrosis	BEFREE	8845182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30154415	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27848972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	30634975, 31311916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17265155, 24292093, 30299246, 9232436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	17052298, 19117745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	23639073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	26780194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	29901120, 30804325	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16618752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16618752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22057037, 30796034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17479287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35877235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	24292093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30572540	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	27796151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	32588760, 35486941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29053414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17549409, 25526479, 28854064, 9287972		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	28441588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26503215, 30816487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34517533	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	24292093		★★★★★ ★☆☆☆☆ Found in Text Mining only

CXCL5 (C-X-C motif chemokine ligand 5)