CXCL6 (C-X-C motif chemokine ligand 6)

Gene

• Entrez ID: 6372
• Gene name: C-X-C motif chemokine ligand 6
• Gene symbol: CXCL6
• Synonyms (NCBI Gene): CKA-3, GCP-2, GCP2, SCYB6
• Chromosome: 4
• Chromosome location: 4q13.3
• Summary: The protein encoded by this gene is a member CXC chemokine family. The encoded protein is a chemotactic for neutrophil granulocytes and has antibacterial action against gram-negative and gram-positive bacteria. This gene and other members of the CXC chemo

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029714	hsa-miR-26b-5p	Microarray	19088304
MIRT650703	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT650702	hsa-miR-4798-5p	HITS-CLIP	23824327
MIRT650703	hsa-miR-140-3p	HITS-CLIP	23824327
MIRT650702	hsa-miR-4798-5p	HITS-CLIP	23824327
MIRT918109	hsa-miR-3148	CLIP-seq
MIRT918110	hsa-miR-3668	CLIP-seq
MIRT918111	hsa-miR-3688-3p	CLIP-seq
MIRT918112	hsa-miR-425	CLIP-seq
MIRT918113	hsa-miR-4694-3p	CLIP-seq
MIRT918114	hsa-miR-548aa	CLIP-seq
MIRT918115	hsa-miR-548ac	CLIP-seq
MIRT918116	hsa-miR-548d-3p	CLIP-seq
MIRT918117	hsa-miR-548n	CLIP-seq
MIRT918118	hsa-miR-548t	CLIP-seq
MIRT918119	hsa-miR-548z	CLIP-seq
MIRT918120	hsa-miR-642b	CLIP-seq
MIRT2207935	hsa-miR-1285	CLIP-seq
MIRT2207936	hsa-miR-3187-5p	CLIP-seq
MIRT2207937	hsa-miR-361-3p	CLIP-seq
MIRT2207938	hsa-miR-3973	CLIP-seq
MIRT2207939	hsa-miR-4463	CLIP-seq
MIRT2207940	hsa-miR-520g	CLIP-seq
MIRT2207941	hsa-miR-520h	CLIP-seq
MIRT2207942	hsa-miR-612	CLIP-seq
MIRT2436555	hsa-miR-101	CLIP-seq
MIRT2436556	hsa-miR-1276	CLIP-seq
MIRT2436557	hsa-miR-144	CLIP-seq
MIRT2436558	hsa-miR-199a-5p	CLIP-seq
MIRT2436559	hsa-miR-199b-5p	CLIP-seq
MIRT2436560	hsa-miR-3121-3p	CLIP-seq
MIRT2436561	hsa-miR-3130-5p	CLIP-seq
MIRT2436562	hsa-miR-329	CLIP-seq
MIRT2436563	hsa-miR-362-3p	CLIP-seq
MIRT2436564	hsa-miR-374c	CLIP-seq
MIRT2436565	hsa-miR-4255	CLIP-seq
MIRT2436566	hsa-miR-4311	CLIP-seq
MIRT2436567	hsa-miR-4482	CLIP-seq
MIRT2436568	hsa-miR-4803	CLIP-seq
MIRT2436569	hsa-miR-576-5p	CLIP-seq
MIRT2436570	hsa-miR-583	CLIP-seq
MIRT918120	hsa-miR-642b	CLIP-seq
MIRT2436571	hsa-miR-655	CLIP-seq
MIRT2436572	hsa-miR-802	CLIP-seq
MIRT2511404	hsa-miR-1	CLIP-seq
MIRT2436555	hsa-miR-101	CLIP-seq
MIRT2511405	hsa-miR-106a	CLIP-seq
MIRT2511406	hsa-miR-106b	CLIP-seq
MIRT2511407	hsa-miR-1253	CLIP-seq
MIRT2511408	hsa-miR-1257	CLIP-seq
MIRT2436556	hsa-miR-1276	CLIP-seq
MIRT2511409	hsa-miR-129-3p	CLIP-seq
MIRT2511410	hsa-miR-130a	CLIP-seq
MIRT2511411	hsa-miR-130b	CLIP-seq
MIRT2511412	hsa-miR-1323	CLIP-seq
MIRT2436557	hsa-miR-144	CLIP-seq
MIRT2511413	hsa-miR-17	CLIP-seq
MIRT2436558	hsa-miR-199a-5p	CLIP-seq
MIRT2436559	hsa-miR-199b-5p	CLIP-seq
MIRT2511414	hsa-miR-206	CLIP-seq
MIRT2511415	hsa-miR-20a	CLIP-seq
MIRT2511416	hsa-miR-20b	CLIP-seq
MIRT2511417	hsa-miR-2355-5p	CLIP-seq
MIRT2511418	hsa-miR-301a	CLIP-seq
MIRT2511419	hsa-miR-301b	CLIP-seq
MIRT2436560	hsa-miR-3121-3p	CLIP-seq
MIRT2511420	hsa-miR-3123	CLIP-seq
MIRT2511421	hsa-miR-3130-3p	CLIP-seq
MIRT2436561	hsa-miR-3130-5p	CLIP-seq
MIRT918109	hsa-miR-3148	CLIP-seq
MIRT2511422	hsa-miR-3174	CLIP-seq
MIRT2511423	hsa-miR-3200-5p	CLIP-seq
MIRT2436562	hsa-miR-329	CLIP-seq
MIRT2511424	hsa-miR-337-3p	CLIP-seq
MIRT2511425	hsa-miR-3606	CLIP-seq
MIRT2511426	hsa-miR-3617	CLIP-seq
MIRT2436563	hsa-miR-362-3p	CLIP-seq
MIRT2511427	hsa-miR-3647-3p	CLIP-seq
MIRT2511428	hsa-miR-3653	CLIP-seq
MIRT2511429	hsa-miR-3666	CLIP-seq
MIRT2511430	hsa-miR-3685	CLIP-seq
MIRT2511431	hsa-miR-3689a-5p	CLIP-seq
MIRT2511432	hsa-miR-3689b	CLIP-seq
MIRT2511433	hsa-miR-3689e	CLIP-seq
MIRT2511434	hsa-miR-3689f	CLIP-seq
MIRT2436564	hsa-miR-374c	CLIP-seq
MIRT2511435	hsa-miR-384	CLIP-seq
MIRT2511436	hsa-miR-3913-3p	CLIP-seq
MIRT2511437	hsa-miR-3938	CLIP-seq
MIRT2511438	hsa-miR-421	CLIP-seq
MIRT2436565	hsa-miR-4255	CLIP-seq
MIRT2511439	hsa-miR-4295	CLIP-seq
MIRT2436566	hsa-miR-4311	CLIP-seq
MIRT2511440	hsa-miR-4427	CLIP-seq
MIRT2511441	hsa-miR-4432	CLIP-seq
MIRT2511442	hsa-miR-4469	CLIP-seq
MIRT2511443	hsa-miR-4476	CLIP-seq
MIRT2511444	hsa-miR-4477b	CLIP-seq
MIRT2436567	hsa-miR-4482	CLIP-seq
MIRT2511445	hsa-miR-4511	CLIP-seq
MIRT2511446	hsa-miR-454	CLIP-seq
MIRT2511447	hsa-miR-4633-5p	CLIP-seq
MIRT2511448	hsa-miR-4666-5p	CLIP-seq
MIRT2511449	hsa-miR-4680-3p	CLIP-seq
MIRT2511450	hsa-miR-4687-5p	CLIP-seq
MIRT2511451	hsa-miR-4698	CLIP-seq
MIRT2511452	hsa-miR-4709-5p	CLIP-seq
MIRT2511453	hsa-miR-4712-3p	CLIP-seq
MIRT2511454	hsa-miR-4766-5p	CLIP-seq
MIRT2511455	hsa-miR-4778-5p	CLIP-seq
MIRT2511456	hsa-miR-4793-3p	CLIP-seq
MIRT2436568	hsa-miR-4803	CLIP-seq
MIRT2511457	hsa-miR-495	CLIP-seq
MIRT2511458	hsa-miR-499-5p	CLIP-seq
MIRT2511459	hsa-miR-513a-3p	CLIP-seq
MIRT2511460	hsa-miR-519a	CLIP-seq
MIRT2511461	hsa-miR-519b-3p	CLIP-seq
MIRT2511462	hsa-miR-519c-3p	CLIP-seq
MIRT2511463	hsa-miR-519d	CLIP-seq
MIRT2511464	hsa-miR-522	CLIP-seq
MIRT2511465	hsa-miR-544	CLIP-seq
MIRT918114	hsa-miR-548aa	CLIP-seq
MIRT2511466	hsa-miR-548b-3p	CLIP-seq
MIRT918117	hsa-miR-548n	CLIP-seq
MIRT2511467	hsa-miR-548o	CLIP-seq
MIRT918118	hsa-miR-548t	CLIP-seq
MIRT2511468	hsa-miR-568	CLIP-seq
MIRT2436569	hsa-miR-576-5p	CLIP-seq
MIRT2436570	hsa-miR-583	CLIP-seq
MIRT2511469	hsa-miR-587	CLIP-seq
MIRT2511470	hsa-miR-590-3p	CLIP-seq
MIRT2511471	hsa-miR-600	CLIP-seq
MIRT2511472	hsa-miR-613	CLIP-seq
MIRT2511473	hsa-miR-641	CLIP-seq
MIRT918120	hsa-miR-642b	CLIP-seq
MIRT2436571	hsa-miR-655	CLIP-seq
MIRT2511474	hsa-miR-656	CLIP-seq
MIRT2436572	hsa-miR-802	CLIP-seq
MIRT2511475	hsa-miR-875-5p	CLIP-seq
MIRT2511476	hsa-miR-889	CLIP-seq
MIRT2511477	hsa-miR-93	CLIP-seq
MIRT2511478	hsa-miR-938	CLIP-seq
MIRT2511404	hsa-miR-1	CLIP-seq
MIRT2436555	hsa-miR-101	CLIP-seq
MIRT2511405	hsa-miR-106a	CLIP-seq
MIRT2511406	hsa-miR-106b	CLIP-seq
MIRT2511407	hsa-miR-1253	CLIP-seq
MIRT2511408	hsa-miR-1257	CLIP-seq
MIRT2436556	hsa-miR-1276	CLIP-seq
MIRT2511409	hsa-miR-129-3p	CLIP-seq
MIRT2511410	hsa-miR-130a	CLIP-seq
MIRT2511411	hsa-miR-130b	CLIP-seq
MIRT2511412	hsa-miR-1323	CLIP-seq
MIRT2436557	hsa-miR-144	CLIP-seq
MIRT2511413	hsa-miR-17	CLIP-seq
MIRT2436558	hsa-miR-199a-5p	CLIP-seq
MIRT2436559	hsa-miR-199b-5p	CLIP-seq
MIRT2511414	hsa-miR-206	CLIP-seq
MIRT2511415	hsa-miR-20a	CLIP-seq
MIRT2511416	hsa-miR-20b	CLIP-seq
MIRT2511417	hsa-miR-2355-5p	CLIP-seq
MIRT2511418	hsa-miR-301a	CLIP-seq
MIRT2511419	hsa-miR-301b	CLIP-seq
MIRT2436560	hsa-miR-3121-3p	CLIP-seq
MIRT2511420	hsa-miR-3123	CLIP-seq
MIRT2511421	hsa-miR-3130-3p	CLIP-seq
MIRT2436561	hsa-miR-3130-5p	CLIP-seq
MIRT918109	hsa-miR-3148	CLIP-seq
MIRT2511422	hsa-miR-3174	CLIP-seq
MIRT2511423	hsa-miR-3200-5p	CLIP-seq
MIRT2436562	hsa-miR-329	CLIP-seq
MIRT2511424	hsa-miR-337-3p	CLIP-seq
MIRT2678873	hsa-miR-338-5p	CLIP-seq
MIRT2511425	hsa-miR-3606	CLIP-seq
MIRT2511426	hsa-miR-3617	CLIP-seq
MIRT2436563	hsa-miR-362-3p	CLIP-seq
MIRT2511427	hsa-miR-3647-3p	CLIP-seq
MIRT2511428	hsa-miR-3653	CLIP-seq
MIRT2511429	hsa-miR-3666	CLIP-seq
MIRT2511430	hsa-miR-3685	CLIP-seq
MIRT2511431	hsa-miR-3689a-5p	CLIP-seq
MIRT2511432	hsa-miR-3689b	CLIP-seq
MIRT2511433	hsa-miR-3689e	CLIP-seq
MIRT2511434	hsa-miR-3689f	CLIP-seq
MIRT2436564	hsa-miR-374c	CLIP-seq
MIRT2511435	hsa-miR-384	CLIP-seq
MIRT2511436	hsa-miR-3913-3p	CLIP-seq
MIRT2511437	hsa-miR-3938	CLIP-seq
MIRT2511438	hsa-miR-421	CLIP-seq
MIRT2436565	hsa-miR-4255	CLIP-seq
MIRT2511439	hsa-miR-4295	CLIP-seq
MIRT2436566	hsa-miR-4311	CLIP-seq
MIRT2511440	hsa-miR-4427	CLIP-seq
MIRT2511441	hsa-miR-4432	CLIP-seq
MIRT2511442	hsa-miR-4469	CLIP-seq
MIRT2511443	hsa-miR-4476	CLIP-seq
MIRT2511444	hsa-miR-4477b	CLIP-seq
MIRT2436567	hsa-miR-4482	CLIP-seq
MIRT2511445	hsa-miR-4511	CLIP-seq
MIRT2511446	hsa-miR-454	CLIP-seq
MIRT2511447	hsa-miR-4633-5p	CLIP-seq
MIRT2678874	hsa-miR-4666-3p	CLIP-seq
MIRT2511448	hsa-miR-4666-5p	CLIP-seq
MIRT2511449	hsa-miR-4680-3p	CLIP-seq
MIRT2511450	hsa-miR-4687-5p	CLIP-seq
MIRT2511451	hsa-miR-4698	CLIP-seq
MIRT2511452	hsa-miR-4709-5p	CLIP-seq
MIRT2511453	hsa-miR-4712-3p	CLIP-seq
MIRT2511454	hsa-miR-4766-5p	CLIP-seq
MIRT2511455	hsa-miR-4778-5p	CLIP-seq
MIRT2511456	hsa-miR-4793-3p	CLIP-seq
MIRT2436568	hsa-miR-4803	CLIP-seq
MIRT2511457	hsa-miR-495	CLIP-seq
MIRT2511458	hsa-miR-499-5p	CLIP-seq
MIRT2511459	hsa-miR-513a-3p	CLIP-seq
MIRT2511460	hsa-miR-519a	CLIP-seq
MIRT2511461	hsa-miR-519b-3p	CLIP-seq
MIRT2511462	hsa-miR-519c-3p	CLIP-seq
MIRT2511463	hsa-miR-519d	CLIP-seq
MIRT2511464	hsa-miR-522	CLIP-seq
MIRT2511465	hsa-miR-544	CLIP-seq
MIRT918114	hsa-miR-548aa	CLIP-seq
MIRT2511466	hsa-miR-548b-3p	CLIP-seq
MIRT918117	hsa-miR-548n	CLIP-seq
MIRT2511467	hsa-miR-548o	CLIP-seq
MIRT918118	hsa-miR-548t	CLIP-seq
MIRT2511468	hsa-miR-568	CLIP-seq
MIRT2436569	hsa-miR-576-5p	CLIP-seq
MIRT2436570	hsa-miR-583	CLIP-seq
MIRT2511469	hsa-miR-587	CLIP-seq
MIRT2511470	hsa-miR-590-3p	CLIP-seq
MIRT2511471	hsa-miR-600	CLIP-seq
MIRT2511472	hsa-miR-613	CLIP-seq
MIRT2511473	hsa-miR-641	CLIP-seq
MIRT918120	hsa-miR-642b	CLIP-seq
MIRT2436571	hsa-miR-655	CLIP-seq
MIRT2511474	hsa-miR-656	CLIP-seq
MIRT2436572	hsa-miR-802	CLIP-seq
MIRT2511475	hsa-miR-875-5p	CLIP-seq
MIRT2511476	hsa-miR-889	CLIP-seq
MIRT2511477	hsa-miR-93	CLIP-seq
MIRT2511478	hsa-miR-938	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001776	Process	Leukocyte homeostasis	IEA
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	28381538
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	9164944
GO:0006952	Process	Defense response	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	TAS	9164944
GO:0007267	Process	Cell-cell signaling	TAS	9164944
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IDA	8399143
GO:0008009	Function	Chemokine activity	IEA
GO:0008201	Function	Heparin binding	IEA
GO:0030593	Process	Neutrophil chemotaxis	IBA
GO:0030593	Process	Neutrophil chemotaxis	IDA	8399143
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032642	Process	Regulation of chemokine production	IEA
GO:0042119	Process	Neutrophil activation	IDA	8399143
GO:0042742	Process	Defense response to bacterium	IEA
GO:0045236	Function	CXCR chemokine receptor binding	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	8399143
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA
GO:0070951	Process	Regulation of neutrophil mediated killing of gram-negative bacterium	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	8399143
GO:0140367	Process	Antibacterial innate immune response	IEA

Other IDs

• MIM: 138965
• HGNC: 10643
• e!Ensembl: ENSG00000124875

Protein

• UniProt ID: P80162
• Protein name: C-X-C motif chemokine 6 (Chemokine alpha 3) (CKA-3) (Granulocyte chemotactic protein 2) (GCP-2) (Small-inducible cytokine B6) [Cleaved into: Small-inducible cytokine B6, N-processed variant 1; Small-inducible cytokine B6, N-processed variant 2; Small-indu
• Protein function: Chemotactic for neutrophil granulocytes. Signals through binding and activation of its receptors (CXCR1 and CXCR2). In addition to its chemotactic and angiogenic properties, it has strong antibacterial activity against Gram-positive and Gram-neg
• PDB: 8XWM, 8XXX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	47 → 106	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Sequence:

  MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNP
  KTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN

• Sequence length: 114

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
IL-17 signaling pathway
TNF signaling pathway
Pertussis
Rheumatoid arthritis

Reactome:

Chemokine receptors bind chemokines
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Age related macular degeneration	Age-related macular degeneration	BEFREE	30157273		★☆☆☆☆ Found in Text Mining only
Anencephaly	Anencephaly	BEFREE	20047525		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	40008515	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	17197447		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	28012239	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	26079448		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	17265155		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18045955	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25323032, 36975480	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25512506, 29136957		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30915738		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30915738		★☆☆☆☆ Found in Text Mining only
Choroid Plexus Carcinoma	Choroid Plexus Carcinoma	BEFREE	28970523		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	16776676		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28811711		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36246978	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18578857		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28811711, 29850390, 34419055	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	27032929		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	19394322		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	16776676		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	15214047		★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	22886775		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	25993443		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	25993443	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	15292528, 17265155		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	CTD_human_DG	15292528		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	30967776		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	39343172	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30106235		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	27520585		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26079448		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26079448		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	31630790		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	32938960	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	30157273		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	36056316	Associate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	28147379		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome, Familial	Guillain-Barre Syndrome	BEFREE	28147379		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	29784904	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	26709788	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16721367, 24825423	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25323032, 33167688, 36307751	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	15214047	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	18842116	Stimulate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35042389	Associate	★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	28012239		★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	BEFREE	30106235		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	32938960	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33167688	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20970952, 25323032		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	40025620	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36975413	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25512506, 29136957		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27384993		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25512506		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30915738		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28811711		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21236563		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35319783	Associate	★☆☆☆☆ Found in Text Mining only
Meningomyelocele	Meningomyelocele	BEFREE	20047525		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	31630790		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25268740	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	22886775		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11583968, 21236563, 25919140, 26079448		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	20047525		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	27604189	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29136957, 30774371		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29784904	Inhibit	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	33487124	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	15292528		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	20806347, 9057843	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	9054580		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29157747	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	18842116	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	35154475	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27384993		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25909173, 27384993	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	27384993		★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	28507181		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	15292528		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	16721367	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	24587171		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37161430	Stimulate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28507181		★☆☆☆☆ Found in Text Mining only
Tonsillitis	Tonsillitis	Pubtator	15008987	Stimulate	★☆☆☆☆ Found in Text Mining only
Tonsillitis	Tonsillitis	Pubtator	15807854	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35377948	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	24637010		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28285559	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34517533	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	28507181		★☆☆☆☆ Found in Text Mining only