Gene Gene information from NCBI Gene database.
Entrez ID 6360
Gene name C-C motif chemokine ligand 16
Gene symbol CCL16
Synonyms (NCBI Gene)
CKb12HCC-4ILINCKLCC-1LECLMCMtn-1NCC-4NCC4SCYA16SCYL4
Chromosome 17
Chromosome location 17q12
Summary This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines.
miRNA miRNA information provided by mirtarbase database.
549
miRTarBase ID miRNA Experiments Reference
MIRT620740 hsa-miR-4742-5p HITS-CLIP 23824327
MIRT620739 hsa-miR-4269 HITS-CLIP 23824327
MIRT620738 hsa-miR-6715b-5p HITS-CLIP 23824327
MIRT620737 hsa-miR-4514 HITS-CLIP 23824327
MIRT620736 hsa-miR-4692 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IEA
GO:0005515 Function Protein binding IPI 28381538, 32296183
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601394 10614 ENSG00000275152
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O15467
Protein name C-C motif chemokine 16 (Chemokine CC-4) (HCC-4) (Chemokine LEC) (IL-10-inducible chemokine) (LCC-1) (Liver-expressed chemokine) (Lymphocyte and monocyte chemoattractant) (LMC) (Monotactin-1) (MTN-1) (NCC-4) (Small-inducible cytokine A16)
Protein function Shows chemotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chemotactic activity for monocytes and THP-
PDB 5LTL , 7SCT , 8FK9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 35 90 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Tissue specificity TISSUE SPECIFICITY: Mainly expressed in liver, also found in spleen and thymus. Highly expressed in LPS- and IFN-gamma-activated monocytes, weakly in some lymphocytes, including natural killer cells, gamma-delta T-cells, and some T-cell clones.
Sequence
MKVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNC
HLPAIIFVTKRNREVCTNPNDDWVQEYIKD
PNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
Sequence length 120
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
  Chemokine receptors bind chemokines
G alpha (i) signalling events
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BREAST CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HAND GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 15034014
★☆☆☆☆
Found in Text Mining only
Aniridia Aniridia Pubtator 34827649 Associate
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 25744065, 29159778
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Breast neoplasm Pubtator 19936789 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 38274805 Associate
★☆☆☆☆
Found in Text Mining only
Cataract Cataract BEFREE 30713426
★☆☆☆☆
Found in Text Mining only
cervical cancer Cervical Cancer BEFREE 24698523
★☆☆☆☆
Found in Text Mining only
Cervix carcinoma Cervix carcinoma BEFREE 24698523
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 33779485 Associate
★☆☆☆☆
Found in Text Mining only
Constipation Constipation Pubtator 21951809 Stimulate
★☆☆☆☆
Found in Text Mining only