CCL8 (C-C motif chemokine ligand 8)

Gene

• Entrez ID: 6355
• Gene name: C-C motif chemokine ligand 8
• Gene symbol: CCL8
• Synonyms (NCBI Gene): HC14, MCP-2, MCP2, SCYA10, SCYA8
• Chromosome: 17
• Chromosome location: 17q12
• Summary: This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT050431	hsa-miR-23a-3p	CLASH	23622248
MIRT438289	hsa-miR-92a-3p	Luciferase reporter assay, Western blot, qRT-PCR	25253336
MIRT438289	hsa-miR-92a-3p	Luciferase reporter assay, Western blot, qRT-PCR	25253336
MIRT871120	hsa-miR-1226	CLIP-seq
MIRT871121	hsa-miR-1290	CLIP-seq
MIRT871122	hsa-miR-181a	CLIP-seq
MIRT871123	hsa-miR-181b	CLIP-seq
MIRT871124	hsa-miR-181c	CLIP-seq
MIRT871125	hsa-miR-181d	CLIP-seq
MIRT871126	hsa-miR-33a	CLIP-seq
MIRT871127	hsa-miR-33b	CLIP-seq
MIRT871128	hsa-miR-4262	CLIP-seq
MIRT871129	hsa-miR-450b-5p	CLIP-seq
MIRT871130	hsa-miR-4733-3p	CLIP-seq
MIRT871131	hsa-miR-499-3p	CLIP-seq
MIRT871132	hsa-miR-499a-3p	CLIP-seq
MIRT871133	hsa-miR-507	CLIP-seq
MIRT871134	hsa-miR-557	CLIP-seq
MIRT1958661	hsa-miR-1305	CLIP-seq
MIRT1958662	hsa-miR-203	CLIP-seq
MIRT1958663	hsa-miR-4698	CLIP-seq
MIRT1958664	hsa-miR-607	CLIP-seq
MIRT871120	hsa-miR-1226	CLIP-seq
MIRT2498686	hsa-miR-1324	CLIP-seq
MIRT2498687	hsa-miR-186	CLIP-seq
MIRT2498688	hsa-miR-1910	CLIP-seq
MIRT2498689	hsa-miR-216a	CLIP-seq
MIRT2498690	hsa-miR-216b	CLIP-seq
MIRT2498691	hsa-miR-3065-5p	CLIP-seq
MIRT2498692	hsa-miR-3613-3p	CLIP-seq
MIRT2498693	hsa-miR-3653	CLIP-seq
MIRT2498694	hsa-miR-3658	CLIP-seq
MIRT2498695	hsa-miR-3670	CLIP-seq
MIRT2498696	hsa-miR-3682-3p	CLIP-seq
MIRT2498697	hsa-miR-3689a-3p	CLIP-seq
MIRT2498698	hsa-miR-3689c	CLIP-seq
MIRT2498699	hsa-miR-3691-5p	CLIP-seq
MIRT2498700	hsa-miR-4264	CLIP-seq
MIRT2498701	hsa-miR-4266	CLIP-seq
MIRT2498702	hsa-miR-4419a	CLIP-seq
MIRT2498703	hsa-miR-4424	CLIP-seq
MIRT2498704	hsa-miR-4493	CLIP-seq
MIRT2498705	hsa-miR-4510	CLIP-seq
MIRT2498706	hsa-miR-4522	CLIP-seq
MIRT2498707	hsa-miR-455-3p	CLIP-seq
MIRT2498708	hsa-miR-4695-5p	CLIP-seq
MIRT2498709	hsa-miR-4700-3p	CLIP-seq
MIRT2498710	hsa-miR-4716-5p	CLIP-seq
MIRT2498711	hsa-miR-4728-5p	CLIP-seq
MIRT871130	hsa-miR-4733-3p	CLIP-seq
MIRT2498712	hsa-miR-4751	CLIP-seq
MIRT2498713	hsa-miR-4752	CLIP-seq
MIRT2498714	hsa-miR-4753-3p	CLIP-seq
MIRT2498715	hsa-miR-4764-5p	CLIP-seq
MIRT2498716	hsa-miR-4779	CLIP-seq
MIRT2498717	hsa-miR-4797-3p	CLIP-seq
MIRT871131	hsa-miR-499-3p	CLIP-seq
MIRT871132	hsa-miR-499a-3p	CLIP-seq
MIRT2498718	hsa-miR-5095	CLIP-seq
MIRT2498719	hsa-miR-5096	CLIP-seq
MIRT2498720	hsa-miR-513a-5p	CLIP-seq
MIRT2498721	hsa-miR-520g	CLIP-seq
MIRT2498722	hsa-miR-520h	CLIP-seq
MIRT2498723	hsa-miR-548c-3p	CLIP-seq
MIRT2498724	hsa-miR-570	CLIP-seq
MIRT2498725	hsa-miR-640	CLIP-seq
MIRT2498726	hsa-miR-656	CLIP-seq
MIRT2498727	hsa-miR-944	CLIP-seq
MIRT871120	hsa-miR-1226	CLIP-seq
MIRT871121	hsa-miR-1290	CLIP-seq
MIRT2498686	hsa-miR-1324	CLIP-seq
MIRT2498687	hsa-miR-186	CLIP-seq
MIRT2498688	hsa-miR-1910	CLIP-seq
MIRT2498689	hsa-miR-216a	CLIP-seq
MIRT2498690	hsa-miR-216b	CLIP-seq
MIRT2498691	hsa-miR-3065-5p	CLIP-seq
MIRT2498692	hsa-miR-3613-3p	CLIP-seq
MIRT2498693	hsa-miR-3653	CLIP-seq
MIRT2498694	hsa-miR-3658	CLIP-seq
MIRT2498695	hsa-miR-3670	CLIP-seq
MIRT2498696	hsa-miR-3682-3p	CLIP-seq
MIRT2498697	hsa-miR-3689a-3p	CLIP-seq
MIRT2498698	hsa-miR-3689c	CLIP-seq
MIRT2498699	hsa-miR-3691-5p	CLIP-seq
MIRT2498700	hsa-miR-4264	CLIP-seq
MIRT2498701	hsa-miR-4266	CLIP-seq
MIRT2498702	hsa-miR-4419a	CLIP-seq
MIRT2498703	hsa-miR-4424	CLIP-seq
MIRT2498704	hsa-miR-4493	CLIP-seq
MIRT871129	hsa-miR-450b-5p	CLIP-seq
MIRT2498705	hsa-miR-4510	CLIP-seq
MIRT2498706	hsa-miR-4522	CLIP-seq
MIRT2498707	hsa-miR-455-3p	CLIP-seq
MIRT2498708	hsa-miR-4695-5p	CLIP-seq
MIRT2498709	hsa-miR-4700-3p	CLIP-seq
MIRT2498710	hsa-miR-4716-5p	CLIP-seq
MIRT2498711	hsa-miR-4728-5p	CLIP-seq
MIRT871130	hsa-miR-4733-3p	CLIP-seq
MIRT2498712	hsa-miR-4751	CLIP-seq
MIRT2498713	hsa-miR-4752	CLIP-seq
MIRT2498714	hsa-miR-4753-3p	CLIP-seq
MIRT2498715	hsa-miR-4764-5p	CLIP-seq
MIRT2498716	hsa-miR-4779	CLIP-seq
MIRT2498717	hsa-miR-4797-3p	CLIP-seq
MIRT871131	hsa-miR-499-3p	CLIP-seq
MIRT871132	hsa-miR-499a-3p	CLIP-seq
MIRT871133	hsa-miR-507	CLIP-seq
MIRT2498718	hsa-miR-5095	CLIP-seq
MIRT2498719	hsa-miR-5096	CLIP-seq
MIRT2498720	hsa-miR-513a-5p	CLIP-seq
MIRT2498721	hsa-miR-520g	CLIP-seq
MIRT2498722	hsa-miR-520h	CLIP-seq
MIRT2498723	hsa-miR-548c-3p	CLIP-seq
MIRT871134	hsa-miR-557	CLIP-seq
MIRT2498724	hsa-miR-570	CLIP-seq
MIRT2498725	hsa-miR-640	CLIP-seq
MIRT2498726	hsa-miR-656	CLIP-seq
MIRT2498727	hsa-miR-944	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002687	Process	Positive regulation of leukocyte migration	IEA
GO:0004672	Function	Protein kinase activity	IDA	10734056
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	28381538
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006816	Process	Calcium ion transport	IDA	10734056
GO:0006874	Process	Intracellular calcium ion homeostasis	IDA	10734056
GO:0006887	Process	Exocytosis	IDA	10734056
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	9468473
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	TAS	9119400
GO:0007267	Process	Cell-cell signaling	IDA	10734056
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	9468473
GO:0008201	Function	Heparin binding	IEA
GO:0009615	Process	Response to virus	TAS	9468473
GO:0016004	Function	Phospholipase activator activity	IDA	10734056
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0031640	Process	Killing of cells of another organism	IDA	12949249
GO:0044828	Process	Host-mediated suppression of viral genome replication	IDA	20181935
GO:0045663	Process	Positive regulation of myoblast differentiation	IEA
GO:0048020	Function	CCR chemokine receptor binding	IBA
GO:0048245	Process	Eosinophil chemotaxis	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12949249
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA
GO:0070664	Process	Negative regulation of leukocyte proliferation	IEA
GO:1901741	Process	Positive regulation of myoblast fusion	IEA

Other IDs

• MIM: 602283
• HGNC: 10635
• e!Ensembl: ENSG00000108700

Protein

• UniProt ID: P80075
• Protein name: C-C motif chemokine 8 (HC14) (Monocyte chemoattractant protein 2) (Monocyte chemotactic protein 2) (MCP-2) (Small-inducible cytokine A8) [Cleaved into: MCP-2(6-76)]
• Protein function: Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chemotactic ac
• PDB: 1ESR, 7S59, 7S5A
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	32 → 90	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highest expression found in the small intestine and peripheral blood cells. Intermediate levels seen in the heart, placenta, lung, skeletal muscle, thymus, colon, ovary, spinal cord and pancreas. Low levels seen in the brain, liver, sp
• Sequence:

  MKVSAALLCLLLMAATFSPQGLAQPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCP
  KEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP

• Sequence length: 99

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
ABLEPHARON-MACROSTOMIA SYNDROME	Ablepharon macrostomia syndrome	BEFREE	28611780		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	12115499		★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	29632236		★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	12871422	Inhibit	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30841468		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	17321344	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29956759		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28536301		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	20583211		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27411480	Associate	★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	16755236		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29521598		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	38253462	Stimulate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28536301		★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	29632236		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27181207, 30991022, 31225658		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30451357, 30850664, 33146700, 34160019, 35725915	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33146700, 33682749	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	33146700	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	30841468	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35043231	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30181917		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29037608, 29550454		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25774687, 36136589	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	23014361		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	16755236		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	28821884	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	32280674	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	30359820		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	21217759, 22445417		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26268591	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	19943328		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28536301		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	31758977		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	22445417		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	20181935, 28693588		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	20181935	Inhibit	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	24413261	Stimulate	★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	19415413		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	36973348	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31423262, 31748682		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31423262, 31748682		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22684297, 31748682		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	LHGDN	18256320		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	19302923		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	20583211	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	15770052	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	16755236		★☆☆☆☆ Found in Text Mining only
HFE-Associated Hereditary Hemochromatosis	Hemochromatosis	BEFREE	20583211		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	12115499		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31263103	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28057004		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	28057004	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	35203308	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukostasis	Leukostasis	BEFREE	31758977		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	35203308	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27181207, 28041977, 30991022, 31225658		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30181917		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30841468		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29339207		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	21514686		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26320180		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	32719391, 33688507, 34032721, 35135212	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	33168410	Associate	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	27091721	Stimulate	★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	20943986		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	33545567	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12644822	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19922463		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	18602166		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	18602166	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	35967338	Inhibit	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	20625511	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26320180, 27181207, 30142953, 30902794, 31225658		★☆☆☆☆ Found in Text Mining only
Nephrogenic Fibrosing Dermopathy	Nephrogenic Fibrosing Dermopathy	CTD_human_DG	20959327		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21514686		★☆☆☆☆ Found in Text Mining only
Nongranulomatous uveitis	Nongranulomatous uveitis	BEFREE	30242977		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17456576		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36973348	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30181917		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29170526, 37155466	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30841468		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30841468	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	23845568		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	23418602		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	35203308	Stimulate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	24743863	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	34987646	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	31814701		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	17568789		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19865101, 28450917, 30557125, 30764871		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	17982926	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	28057004, 30242977		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	28057004	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	33682749	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	24743863	Associate	★☆☆☆☆ Found in Text Mining only
SHORT STATURE, IDIOPATHIC, X-LINKED	SHORT STATURE, IDIOPATHIC, X-LINKED	BEFREE	16574937		★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	30557125		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	39185422	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21514686		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29148603		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33545567	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	30902794		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22468089	Associate	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	27896420, 30137540		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35377948	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	23014361, 30065559		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ureteral Obstruction	Urethral obstruction	Pubtator	35203308	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34893045	Associate	★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	20181935		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31263103	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	30242977		★☆☆☆☆ Found in Text Mining only