CCL7 (C-C motif chemokine ligand 7)

Gene

• Entrez ID: 6354
• Gene name: C-C motif chemokine ligand 7
• Gene symbol: CCL7
• Synonyms (NCBI Gene): FIC, MARC, MCP-3, MCP3, NC28, SCYA6, SCYA7
• Chromosome: 17
• Chromosome location: 17q12
• Summary: This gene encodes monocyte chemotactic protein 3, a secreted chemokine which attracts macrophages during inflammation and metastasis. It is a member of the C-C subfamily of chemokines which are characterized by having two adjacent cysteine residues. The p

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029409	hsa-miR-26b-5p	Microarray	19088304
MIRT054392	hsa-let-7f-5p	Luciferase reporter assay	22894925
MIRT1958657	hsa-miR-300	CLIP-seq
MIRT1958658	hsa-miR-381	CLIP-seq
MIRT1958659	hsa-miR-4666-3p	CLIP-seq
MIRT1958660	hsa-miR-4789-5p	CLIP-seq
MIRT2436134	hsa-miR-188-3p	CLIP-seq
MIRT2436135	hsa-miR-324-5p	CLIP-seq
MIRT2436136	hsa-miR-4328	CLIP-seq
MIRT2436137	hsa-miR-765	CLIP-seq
MIRT2436134	hsa-miR-188-3p	CLIP-seq
MIRT2436135	hsa-miR-324-5p	CLIP-seq
MIRT2436136	hsa-miR-4328	CLIP-seq
MIRT2436137	hsa-miR-765	CLIP-seq
MIRT2446479	hsa-let-7a	CLIP-seq
MIRT2446480	hsa-let-7b	CLIP-seq
MIRT2446481	hsa-let-7c	CLIP-seq
MIRT2446482	hsa-let-7d	CLIP-seq
MIRT2446483	hsa-let-7e	CLIP-seq
MIRT2446484	hsa-let-7f	CLIP-seq
MIRT2446485	hsa-let-7g	CLIP-seq
MIRT2446486	hsa-let-7i	CLIP-seq
MIRT2446487	hsa-miR-1321	CLIP-seq
MIRT2446488	hsa-miR-202	CLIP-seq
MIRT2446489	hsa-miR-3123	CLIP-seq
MIRT2446490	hsa-miR-3154	CLIP-seq
MIRT2446491	hsa-miR-3925-5p	CLIP-seq
MIRT2446492	hsa-miR-3927	CLIP-seq
MIRT2446493	hsa-miR-4451	CLIP-seq
MIRT2446494	hsa-miR-4458	CLIP-seq
MIRT2446495	hsa-miR-4500	CLIP-seq
MIRT2446496	hsa-miR-4739	CLIP-seq
MIRT2446497	hsa-miR-4756-5p	CLIP-seq
MIRT2436137	hsa-miR-765	CLIP-seq
MIRT2446498	hsa-miR-98	CLIP-seq
MIRT2446479	hsa-let-7a	CLIP-seq
MIRT2446480	hsa-let-7b	CLIP-seq
MIRT2446481	hsa-let-7c	CLIP-seq
MIRT2446482	hsa-let-7d	CLIP-seq
MIRT2446483	hsa-let-7e	CLIP-seq
MIRT2446484	hsa-let-7f	CLIP-seq
MIRT2446485	hsa-let-7g	CLIP-seq
MIRT2446486	hsa-let-7i	CLIP-seq
MIRT2498670	hsa-miR-1273f	CLIP-seq
MIRT2446487	hsa-miR-1321	CLIP-seq
MIRT2498671	hsa-miR-1323	CLIP-seq
MIRT2498672	hsa-miR-143	CLIP-seq
MIRT2436134	hsa-miR-188-3p	CLIP-seq
MIRT2446488	hsa-miR-202	CLIP-seq
MIRT1958657	hsa-miR-300	CLIP-seq
MIRT2498673	hsa-miR-3120-3p	CLIP-seq
MIRT2446489	hsa-miR-3123	CLIP-seq
MIRT2446490	hsa-miR-3154	CLIP-seq
MIRT2436135	hsa-miR-324-5p	CLIP-seq
MIRT2498674	hsa-miR-338-5p	CLIP-seq
MIRT1958658	hsa-miR-381	CLIP-seq
MIRT2446491	hsa-miR-3925-5p	CLIP-seq
MIRT2446492	hsa-miR-3927	CLIP-seq
MIRT2436136	hsa-miR-4328	CLIP-seq
MIRT2446493	hsa-miR-4451	CLIP-seq
MIRT2446494	hsa-miR-4458	CLIP-seq
MIRT2446495	hsa-miR-4500	CLIP-seq
MIRT2498675	hsa-miR-4640-3p	CLIP-seq
MIRT1958659	hsa-miR-4666-3p	CLIP-seq
MIRT2498676	hsa-miR-4668-3p	CLIP-seq
MIRT2498677	hsa-miR-4699-5p	CLIP-seq
MIRT2498678	hsa-miR-4708-5p	CLIP-seq
MIRT2446496	hsa-miR-4739	CLIP-seq
MIRT2446497	hsa-miR-4756-5p	CLIP-seq
MIRT2498679	hsa-miR-4770	CLIP-seq
MIRT1958660	hsa-miR-4789-5p	CLIP-seq
MIRT2498680	hsa-miR-548aa	CLIP-seq
MIRT2498681	hsa-miR-548ac	CLIP-seq
MIRT2498682	hsa-miR-548d-3p	CLIP-seq
MIRT2498683	hsa-miR-548o	CLIP-seq
MIRT2498684	hsa-miR-548z	CLIP-seq
MIRT2498685	hsa-miR-7	CLIP-seq
MIRT2436137	hsa-miR-765	CLIP-seq
MIRT2446498	hsa-miR-98	CLIP-seq
MIRT2446479	hsa-let-7a	CLIP-seq
MIRT2446480	hsa-let-7b	CLIP-seq
MIRT2446481	hsa-let-7c	CLIP-seq
MIRT2446482	hsa-let-7d	CLIP-seq
MIRT2446483	hsa-let-7e	CLIP-seq
MIRT2446484	hsa-let-7f	CLIP-seq
MIRT2446485	hsa-let-7g	CLIP-seq
MIRT2446486	hsa-let-7i	CLIP-seq
MIRT2498670	hsa-miR-1273f	CLIP-seq
MIRT2446487	hsa-miR-1321	CLIP-seq
MIRT2498671	hsa-miR-1323	CLIP-seq
MIRT2498672	hsa-miR-143	CLIP-seq
MIRT2436134	hsa-miR-188-3p	CLIP-seq
MIRT2446488	hsa-miR-202	CLIP-seq
MIRT1958657	hsa-miR-300	CLIP-seq
MIRT2498673	hsa-miR-3120-3p	CLIP-seq
MIRT2446489	hsa-miR-3123	CLIP-seq
MIRT2446490	hsa-miR-3154	CLIP-seq
MIRT2436135	hsa-miR-324-5p	CLIP-seq
MIRT2498674	hsa-miR-338-5p	CLIP-seq
MIRT1958658	hsa-miR-381	CLIP-seq
MIRT2446491	hsa-miR-3925-5p	CLIP-seq
MIRT2446492	hsa-miR-3927	CLIP-seq
MIRT2436136	hsa-miR-4328	CLIP-seq
MIRT2446493	hsa-miR-4451	CLIP-seq
MIRT2446494	hsa-miR-4458	CLIP-seq
MIRT2446495	hsa-miR-4500	CLIP-seq
MIRT2498675	hsa-miR-4640-3p	CLIP-seq
MIRT1958659	hsa-miR-4666-3p	CLIP-seq
MIRT2498676	hsa-miR-4668-3p	CLIP-seq
MIRT2498677	hsa-miR-4699-5p	CLIP-seq
MIRT2498678	hsa-miR-4708-5p	CLIP-seq
MIRT2446496	hsa-miR-4739	CLIP-seq
MIRT2446497	hsa-miR-4756-5p	CLIP-seq
MIRT2498679	hsa-miR-4770	CLIP-seq
MIRT1958660	hsa-miR-4789-5p	CLIP-seq
MIRT2498683	hsa-miR-548o	CLIP-seq
MIRT2498685	hsa-miR-7	CLIP-seq
MIRT2436137	hsa-miR-765	CLIP-seq
MIRT2446498	hsa-miR-98	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
LEF1	Unknown	11118053

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002548	Process	Monocyte chemotaxis	IC	10660125
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 26095031, 27044744, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	7916328
GO:0006874	Process	Intracellular calcium ion homeostasis	TAS	10770925
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	9780207
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IDA	10748004
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0007010	Process	Cytoskeleton organization	IDA	10072545
GO:0007165	Process	Signal transduction	TAS	10201901, 10770925
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	1406630, 9346484, 10882101, 25038658, 34721373
GO:0007267	Process	Cell-cell signaling	TAS	7916328
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IDA	10072545
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	10770925
GO:0008201	Function	Heparin binding	IEA
GO:0008360	Process	Regulation of cell shape	IDA	10072545
GO:0010332	Process	Response to gamma radiation	IEA
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IDA	1406630, 9346484, 25038658, 34721373
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0030335	Process	Positive regulation of cell migration	IDA	7545673
GO:0031726	Function	CCR1 chemokine receptor binding	IPI	7545673, 10660125
GO:0031727	Function	CCR2 chemokine receptor binding	IEA
GO:0048020	Function	CCR chemokine receptor binding	IBA
GO:0048245	Process	Eosinophil chemotaxis	IBA
GO:0048245	Process	Eosinophil chemotaxis	IDA	10072545
GO:0050729	Process	Positive regulation of inflammatory response	IDA	38417634
GO:0050729	Process	Positive regulation of inflammatory response	IDA	38417634
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA
GO:0071361	Process	Cellular response to ethanol	IEA
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IDA	16968406
GO:2000503	Process	Positive regulation of natural killer cell chemotaxis	IDA	7545673

Other IDs

• MIM: 158106
• HGNC: 10634
• e!Ensembl: ENSG00000108688

Protein

• UniProt ID: P80098
• Protein name: C-C motif chemokine 7 (Monocyte chemoattractant protein 3) (Monocyte chemotactic protein 3) (MCP-3) (NC28) (Small-inducible cytokine A7)
• Protein function: Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. Also induces the release of gelatinase B. This protein can bind heparin. Binds to CCR1, CCR2 and CCR3.
• PDB: 1BO0, 1NCV, 4ZKC, 7S58, 7S59, 7SCU, 8FJ3, 8FK6, 8FK8, 8JPS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	32 → 90	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Sequence:

  MKASAALLCLLLTAAAFSPQGLAQPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCP
  REAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL

• Sequence length: 99

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
IL-17 signaling pathway

Reactome:

Chemokine receptors bind chemokines

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acne	Acne	BEFREE	29574906		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	31322702		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	10359883, 28046055		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	29337222		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22576056		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28536301		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	17178563		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	12854631	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	8998072		★☆☆☆☆ Found in Text Mining only
Atelosteogenesis type 2	Atelosteogenesis	Pubtator	34425224	Inhibit	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28536301		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	28821884	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	37304261	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	21803429		★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	35715847	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11418002		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26896000, 30850664	Associate	★☆☆☆☆ Found in Text Mining only
Bright Disease	Bright Disease	CTD_human_DG	10385480		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33682749	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30214518, 30788000		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24327013, 37902279	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30671055		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	37304261	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	10521584		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11529662		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	CTD_human_DG	21224055		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	BEFREE	31105713		★☆☆☆☆ Found in Text Mining only
Colitis Collagenous	Collagenous colitis	Pubtator	25948880	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	10433925	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22614322, 30764543		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22363134, 33175885, 35283273, 35715847, 36693067	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25193015		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	32360286	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	20570966		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	29201216		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28648867		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	8980953	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	25828150, 31622668		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28536301		★☆☆☆☆ Found in Text Mining only
Digestive System Disorders	Digestive System Disorders	BEFREE	28003130		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	25828150, 31622668		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	21279498		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29308929		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	39817309	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	26748993	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	CTD_human_DG	10385480		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemangiosarcoma	Hemangiosarcoma	BEFREE	14978762		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31320613		★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	24676787		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	15191918		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	34948231	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	29915688		★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	12374626		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10205198		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	10205198	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	23872063		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	37554265	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22468089	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	25162674		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11418002, 28041977		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30214518, 30788000		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22576056		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19937793, 29915688, 30788000		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	25162674	Associate	★☆☆☆☆ Found in Text Mining only
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	12374626		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12644822	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	30948485		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10229131, 12127674		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasal Polyps	Nasal polyposis	BEFREE	9532637		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11529662, 17154174, 19424580, 24068959, 25193015, 29915688, 30671055, 30764543, 30832616, 31322702		★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	CTD_human_DG	10385480		★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	CTD_human_DG	10385480		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	7700633		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	29497397		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30214518		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	20970834		★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	35715847	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36755691, 38567587	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37155466	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22576056		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	30399509		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	31322702		★☆☆☆☆ Found in Text Mining only
POPLITEAL PTERYGIUM SYNDROME, LETHAL TYPE	Bartsocas-Papas syndrome	BEFREE	31410520		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	25828150		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	25970596	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21327296	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21883889, 34335580	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24327013, 25193015		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	27496101		★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	31814701		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	16002730		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25865479, 28450917, 28648867, 28831575, 31300004		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	10359883		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	17982926	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	33682749	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	16014681	Stimulate	★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	BEFREE	9532637		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19937793		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	24676787		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22468089	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	12847692, 16014681		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	12847692		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36347994	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	32701210	Inhibit	★☆☆☆☆ Found in Text Mining only