CCL3 (C-C motif chemokine ligand 3)

Gene

• Entrez ID: 6348
• Gene name: C-C motif chemokine ligand 3
• Gene symbol: CCL3
• Synonyms (NCBI Gene): G0S19-1, LD78, LD78ALPHA, MIP-1-alpha, MIP1A, SCI, SCYA3
• Chromosome: 17
• Chromosome location: 17q12
• Summary: This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT438283	hsa-miR-223-3p	Luciferase reporter assay	24084739
MIRT438283	hsa-miR-223-3p	Luciferase reporter assay	24084739
MIRT736396	hsa-miR-369-3p	qRT-PCR, Flow cytometry	33679688
MIRT756279	hsa-miR-877-3p	qRT-PCR, ELISA	34768991

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Unknown	17707233
NFKB1	Activation	16982926
NFKB1	Unknown	11342414;17707233
RELA	Activation	16982926
RELA	Unknown	11342414;17707233
RUNX1	Activation	12771199
STAT1	Activation	16628196

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEP	12032188
GO:0001649	Process	Osteoblast differentiation	IEP	21403648
GO:0001775	Process	Cell activation	IDA	10706735
GO:0002548	Process	Monocyte chemotaxis	IC	10660125
GO:0002548	Process	Monocyte chemotaxis	IDA	10706735
GO:0004672	Function	Protein kinase activity	IDA	10734056
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	20959807, 21784977, 26095031, 32296183
GO:0005576	Component	Extracellular region	IDA	20041150
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	20167378, 21403648
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IDA	21784977
GO:0005829	Component	Cytosol	IDA	19523456
GO:0006816	Process	Calcium ion transport	IDA	10734056
GO:0006874	Process	Intracellular calcium ion homeostasis	IDA	10072545, 10734056, 21403648
GO:0006887	Process	Exocytosis	IDA	10734056
GO:0006935	Process	Chemotaxis	IDA	10679098
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IDA	10679098, 10706735
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0007010	Process	Cytoskeleton organization	IDA	10072545
GO:0007267	Process	Cell-cell signaling	IDA	10679098
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IDA	10072545, 10660125
GO:0008009	Function	Chemokine activity	IEA
GO:0008360	Process	Regulation of cell shape	IDA	10072545
GO:0009636	Process	Response to toxic substance	IDA	10841574
GO:0010628	Process	Positive regulation of gene expression	IDA	10706735
GO:0010629	Process	Negative regulation of gene expression	IDA	21403648
GO:0010818	Process	T cell chemotaxis	IDA	10706735
GO:0014808	Process	Release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	IDA	19523456
GO:0016004	Function	Phospholipase activator activity	IDA	10734056
GO:0016301	Function	Kinase activity	IDA	21403648
GO:0019722	Process	Calcium-mediated signaling	IDA	10072545, 19523456
GO:0023052	Process	Signaling	IEP	12032188
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0030335	Process	Positive regulation of cell migration	IDA	7545673, 10706735
GO:0030502	Process	Negative regulation of bone mineralization	IDA	21403648
GO:0030593	Process	Neutrophil chemotaxis	IDA	10706735
GO:0031726	Function	CCR1 chemokine receptor binding	IPI	7545673, 8699119, 10660125, 15764707
GO:0031730	Function	CCR5 chemokine receptor binding	IPI	8699119, 10679098
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0042056	Function	Chemoattractant activity	IDA	10072545, 10660125, 10706735, 15001559
GO:0042802	Function	Identical protein binding	IPI	20959807
GO:0043308	Process	Eosinophil degranulation	IDA	10706735
GO:0043525	Process	Positive regulation of neuron apoptotic process	ISS
GO:0043615	Process	Astrocyte cell migration	ISS
GO:0043922	Process	Host-mediated suppression of viral transcription	IDA	10841574
GO:0045671	Process	Negative regulation of osteoclast differentiation	IDA	21403648
GO:0048020	Function	CCR chemokine receptor binding	IBA
GO:0048245	Process	Eosinophil chemotaxis	IDA	10072545
GO:0048246	Process	Macrophage chemotaxis	ISS
GO:0048247	Process	Lymphocyte chemotaxis	IDA	10706735
GO:0050729	Process	Positive regulation of inflammatory response	ISS
GO:0050795	Process	Regulation of behavior	IDA	20167378
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IMP	10679098
GO:0050918	Process	Positive chemotaxis	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEP	21403648
GO:0051928	Process	Positive regulation of calcium ion transport	IDA	8699119, 15764707
GO:0051930	Process	Regulation of sensory perception of pain	IDA	15764707
GO:0060326	Process	Cell chemotaxis	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	21403648
GO:0070723	Process	Response to cholesterol	IDA	19523456
GO:0071346	Process	Cellular response to type II interferon	IEP	9407497
GO:0071347	Process	Cellular response to interleukin-1	IEP	9407497
GO:0071356	Process	Cellular response to tumor necrosis factor	IEP	9407497
GO:0071621	Process	Granulocyte chemotaxis	IDA	10706735
GO:0090280	Process	Positive regulation of calcium ion import	TAS	10925302
GO:1903980	Process	Positive regulation of microglial cell activation	TAS	29518356
GO:1904141	Process	Positive regulation of microglial cell migration	TAS	29518356
GO:2000503	Process	Positive regulation of natural killer cell chemotaxis	IDA	7545673

Other IDs

• MIM: 182283
• HGNC: 10627
• e!Ensembl: ENSG00000277632

Protein

• UniProt ID: P10147
• Protein name: C-C motif chemokine 3 (G0/G1 switch regulatory protein 19-1) (Macrophage inflammatory protein 1-alpha) (MIP-1-alpha) (PAT 464.1) (SIS-beta) (Small-inducible cytokine A3) (Tonsillar lymphocyte LD78 alpha protein) [Cleaved into: MIP-1-alpha(4-69) (LD78-alph
• Protein function: Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, H
• PDB: 1B50, 1B53, 2X69, 2X6G, 3FPU, 3H44, 3KBX, 4RA8, 4ZKB, 5COR, 5D65, 7F1Q, 7F1T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	31 → 88	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Sequence:

  MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP
  GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

• Sequence length: 92

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
Toll-like receptor signaling pathway
Chagas disease
Human cytomegalovirus infection
Rheumatoid arthritis
Lipid and atherosclerosis

Reactome:

Chemokine receptors bind chemokines
Interleukin-10 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	30940905		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	30552706		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	30279500		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	8987092		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	30834503		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30940905		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	27632954		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	21942940, 31592701		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	12608917		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	16324872, 17720292		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30336198, 9665462	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	21859849	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	1586705	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	32411797	Associate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	LHGDN	18619972		★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	BEFREE	29801153		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29402784		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29402784, 31776047		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	31776047	Associate	★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	31615548		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21133894		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16507178, 21784977, 30053130		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	16507178, 22687048	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	15743472, 16507178	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10225815, 11352233, 11966774, 12699431, 12909630, 15077296, 15331395, 15548526, 26314565, 27411480, 30369929, 30402834, 31320744, 37600067, 8132778	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10437780, 15331393, 7521808	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	15548526, 18178867, 18492738, 18774390, 23760409	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	18178867, 25748343		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21133894		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	24370436		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	35052452, 38256102	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	35845739	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	34128902	Inhibit	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28036258, 30609049, 30811821		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	15545055, 16968406	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	24984193	Stimulate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	31393598		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	28694768		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	35136035	Associate	★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	26293297	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	10887133, 12492576, 12506012, 12623842, 16497877, 28677723	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	16263571, 16849642, 21403648, 26419509		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	12181060	Associate	★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	35363329	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	15829914, 17394460		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	22996231		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28041977		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12651610, 16518599, 30814616, 33146700, 9432038	Associate	★☆☆☆☆ Found in Text Mining only
Bright Disease	Bright Disease	CTD_human_DG	10385480		★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	29894204		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	LHGDN	15602730		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	37090732	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12651617, 28427195	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30953795		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26587829, 32469992	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31114450		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	37478026	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	25441669, 37478026	Associate	★☆☆☆☆ Found in Text Mining only
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	31793629		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	24473480		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	39521256	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	24473480		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	34592495	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	30940905		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	24047437	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26458057, 26902783, 27534555, 29099493		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	27783593		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30952808		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	21198766	Stimulate	★☆☆☆☆ Found in Text Mining only
Ciliary Motility Disorders	Ciliary dyskinesia	Pubtator	29116124	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	35262594	Stimulate	★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	35363329	Associate	★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	30858476		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	36737481	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	30227886	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Collagenous	Collagenous colitis	Pubtator	25948880	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	36742294	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	29399390		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29801973, 30890699		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29606345, 30419802, 33893084, 36742294	Associate	★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	19490431		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	12742282	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	16968406	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	17572013		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	34721395	Stimulate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31508417		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	8570619		★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	37957648	Stimulate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27992767, 28594820, 29339257		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	27701668	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	10444253, 11426325, 27701668, 29853747		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	19211157	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	18803760, 26211001	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	16045741, 18803760	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30816669	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29551909, 30098304		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30098304		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	36062083	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30911832		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	30227886	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27825111		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	25222269	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	30356032		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	34048779, 37876509	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	10444253, 11426325, 27701668, 29853747		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	LHGDN	17357337		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	19782379		★☆☆☆☆ Found in Text Mining only
Endocarditis	Endocarditis	BEFREE	7994929		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	27770434		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	10444253		★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	18076643	Stimulate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	18076643		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	31385574	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	32457351	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	22734465	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	22234699		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	22234699		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	25834308	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29363152		★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	29162878	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	25120735	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	11079620	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	25645321		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	31701554		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	32043817	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22307528, 25762141		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22307528, 25762141		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31690954	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	CTD_human_DG	10385480		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	Pubtator	10469367	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	Pubtator	35116032	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	12239181	Stimulate	★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	19490431		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	34925365	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	11451272, 35945262	Stimulate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	30279500		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	10887133		★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	10446112	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	20483710	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	27875997	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	10194423, 11238088	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	27632954		★☆☆☆☆ Found in Text Mining only
Humoral hypercalcemia of malignancy (disorder)	Humoral Hypercalcemia Of Malignancy	BEFREE	18089816		★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	Pubtator	15176993	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	Pubtator	18249060	Associate	★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	20050882, 31592701		★☆☆☆☆ Found in Text Mining only
Hypercalciuria Absorptive 2	Hypercalciuria	Pubtator	27161247	Associate	★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	8514874	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	18290856		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	18290856		★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	34794403	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	32006659	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27129235	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30459756	Inhibit	★☆☆☆☆ Found in Text Mining only
Idiopathic Hypereosinophilic Syndrome	Hypereosinophilic Syndrome	BEFREE	8514874		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	15802346	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	15879152, 34158044	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19117745, 7882902, 9676055		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	16968406	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	10444253		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	18270300	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	24795505, 26439025, 33652921	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	26439025, 28935976, 29551909		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	29551909		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	31316152		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	31316152	Stimulate	★☆☆☆☆ Found in Text Mining only
Intrinsic Factor Deficiency	Intrinsic Factor Deficiency	BEFREE	27343564		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	15743472		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	LHGDN	16507178		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	28491875		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	37433798	Associate	★☆☆☆☆ Found in Text Mining only
Left ventricular systolic dysfunction	Ventricular Systolic Dysfunction	BEFREE	28002786		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	23798993		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	23798993	Inhibit	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	24166712, 24309526, 27783593		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	28596280, 37919606	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36653976	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	14615378, 21957195, 24309526		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	31592701		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	28881626		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	18430964		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	Pubtator	18430964	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12651617		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12651617		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	16284949		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	20548789	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	20548789	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	10446112	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12651617		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	26620310, 40247373	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	7882902		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	9676055		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23762239	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26620310	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30551949, 31479651		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	12586635, 21744323, 26121143	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	17475893, 21744323		★☆☆☆☆ Found in Text Mining only
Lymphoma, Extranodal NK-T-Cell	Lymphoma	BEFREE	26928433		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	34794403	Stimulate	★☆☆☆☆ Found in Text Mining only
Macular dystrophy corneal type 1	Macular dystrophy	Pubtator	34794403	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	20050882		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	25162674		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28041977		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	27770434		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30953795		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	28881626		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22085486, 28041977, 31242243, 8987092		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12651610		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	20050882		★☆☆☆☆ Found in Text Mining only
Meibomian gland dysfunction	Meibomian Gland Dysfunction	BEFREE	29801153		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11369232, 36087066	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	22418780, 28424693, 31519915		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27992767, 28594820, 29339257		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	21266669	Associate	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	31214186	Associate	★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	30266090		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor neuron disease	Pubtator	38001563	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	33155662	Associate	★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	9432038	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10887133, 12492576, 14615378, 16263571, 16849642, 21403648, 21957195, 23178378, 23521677, 23932230, 27983725, 28677723, 28855206, 29057477, 30053130, 30948485		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10887133, 11369623, 12492576, 12506012, 12560229, 14615378, 16497877, 16849642, 17854307, 23178378, 27983725, 35965418	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	12200385, 12560229		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17715391, 28677723	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	10359806, 11696431, 12909630, 15548526	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10960051, 16078049		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	11966770	Stimulate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	1961020, 24166712, 30279500, 7492787, 8251904		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myositis	Myositis	Pubtator	37228600	Associate	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	18420712	Stimulate	★☆☆☆☆ Found in Text Mining only
Myxoma of heart	Myxoma Of Heart	BEFREE	26134542		★☆☆☆☆ Found in Text Mining only
Myxoma of the Endocardium	Myxoma Of The Endocardium	BEFREE	26134542		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	8514874		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	8514874	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	20637487	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29764502, 29807404		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	29807404	Stimulate	★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	28013313		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14508117, 17475893, 17914560, 21942940, 22996231, 23633492, 25762141, 27799249, 28677723, 28881626, 29399390, 30254191, 30834503, 31592701, 31717914, 7669585		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	23916293	Stimulate	★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	29875186		★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	19490431		★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan Syndrome	BEFREE	27783593		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	16059715, 23760409, 30816669, 31320744, 33809270, 35894174	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27677832, 32469992	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30816669		★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic neuritis	Pubtator	11966770	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	10437780, 11966774	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	39639239	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	32006659	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	32006659	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	25151085		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	31590365		★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	17729302	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	24795505		★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	Pubtator	24795505	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28062298, 30053130		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	38567587	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	10691855	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26713602		★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	28847849		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11978786	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	39372399	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30254191		★☆☆☆☆ Found in Text Mining only
Papillon-Lefevre Disease	Papillon-Lefevre Disease	LHGDN	15728180		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	34764955	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	18678243		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	33570220	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigoid Benign Mucous Membrane	Benign mucous membrane pemphigoid	Pubtator	18211946	Stimulate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	11472436	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	31701554		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	35363329	Stimulate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	11472436	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	31701554		★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	19490431		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	30911832		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	29339257		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	8570619		★☆☆☆☆ Found in Text Mining only
Primary hyperoxaluria type 1	Hyperoxaluria	Pubtator	27161247	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30760013		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25183374, 34335580	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	10403930, 12449175, 8187326	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	16324872, 17720292		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinal Detachment	Retinal detachment	Pubtator	34544594	Associate	★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	39472110	Stimulate	★☆☆☆☆ Found in Text Mining only
Rhegmatogenous Retinal Detachment Autosomal Dominant	Rhegmatogenous retinal detachment	Pubtator	32542038	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	23417848	Stimulate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10225815, 20518837, 28912850, 30402834, 30510188, 31320744		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15077296		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	38022554	Stimulate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	31377797		★☆☆☆☆ Found in Text Mining only
Sandhoff Disease	Sandhoff Disease	BEFREE	15155903		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	11803051, 7882902, 9676055		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	12746045, 25004830, 9528906	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	12449175	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	24984193	Stimulate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	10403930	Stimulate	★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	29466439		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	31086200	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	30053130		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	27623398		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	30858476		★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	28677732		★☆☆☆☆ Found in Text Mining only
Splenic Hypoplasia	Splenic Hypoplasia	BEFREE	25441669		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17914560		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20622890, 25060177, 33155662	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	22085486		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	19490431		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	19490431		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	17183455	Stimulate	★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	22412179		★☆☆☆☆ Found in Text Mining only
Synovial Hypertrophy	Synovial Hypertrophy	BEFREE	27514996		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	26928433		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35377948	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	18762952, 23014361		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34893045	Associate	★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	19729323	Stimulate	★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	32542038	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	29685422		★☆☆☆☆ Found in Text Mining only
Xanthomatosis	Xanthomatosis	Pubtator	24428816	Associate	★☆☆☆☆ Found in Text Mining only