Gene Gene information from NCBI Gene database.
Entrez ID 6347
Gene name C-C motif chemokine ligand 2
Gene symbol CCL2
Synonyms (NCBI Gene)
GDCF-2HC11HSMCR30MCAFMCP-1MCP1SCYA2SMC-CF
Chromosome 17
Chromosome location 17q12
Summary This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the ar
miRNA miRNA information provided by mirtarbase database.
34
miRTarBase ID miRNA Experiments Reference
MIRT004284 hsa-miR-124-3p Luciferase reporter assay 19404929
MIRT021047 hsa-miR-155-5p Proteomics 18668040
MIRT024058 hsa-miR-1-3p Microarray 18668037
MIRT030277 hsa-miR-26b-5p Microarray 19088304
MIRT030558 hsa-miR-24-3p Microarray 19748357
Transcription factors Transcription factors information provided by TRRUST V2 database.
22
Transcription factor Regulation Reference
APEX1 Activation 17045925
ATF4 Unknown 16931790
CEBPA Activation 24429361
HDAC2 Unknown 22679019
IRF3 Unknown 20483755
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
73
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis TAS 18334747
GO:0002548 Process Monocyte chemotaxis IDA 12207323
GO:0004672 Function Protein kinase activity TAS 9973507
GO:0005102 Function Signaling receptor binding TAS 10542238
GO:0005125 Function Cytokine activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
158105 10618 ENSG00000108691
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P13500
Protein name C-C motif chemokine 2 (HC11) (Monocyte chemoattractant protein 1) (Monocyte chemotactic and activating factor) (MCAF) (Monocyte chemotactic protein 1) (MCP-1) (Monocyte secretory protein JE) (Small-inducible cytokine A2)
Protein function Acts as a ligand for C-C chemokine receptor CCR2 (PubMed:10529171, PubMed:10587439, PubMed:9837883). Signals through binding and activation of CCR2 and induces a strong chemotactic response and mobilization of intracellular calcium ions (PubMed:
PDB 1DOK , 1DOL , 1DOM , 1DON , 1ML0 , 2BDN , 2NZ1 , 3IFD , 4DN4 , 4R8I , 4ZK9 , 7SO0 , 7XA3 , 8FJ0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 32 90 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the seminal plasma, endometrial fluid and follicular fluid (at protein level) (PubMed:23765988). Expressed in monocytes (PubMed:2513477). {ECO:0000269|PubMed:23765988, ECO:0000269|PubMed:2513477}.
Sequence
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
KEAVIFKTIVAKEICADPKQKWVQDSMDHL
DKQTQTPKT
Sequence length 99
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
NOD-like receptor signaling pathway
IL-17 signaling pathway
TNF signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Yersinia infection
Chagas disease
Malaria
Human cytomegalovirus infection
Influenza A
Herpes simplex virus 1 infection
Coronavirus disease - COVID-19
Rheumatoid arthritis
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis
  Chemokine receptors bind chemokines
ATF4 activates genes in response to endoplasmic reticulum stress
Interleukin-10 signaling
Interleukin-4 and Interleukin-13 signaling
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
88
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ANKYLOSING SPONDYLITIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANTERIOR UVEITIS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ASTHMA CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Abetalipoproteinemia Abetalipoproteinemia BEFREE 24112389
★☆☆☆☆
Found in Text Mining only
Acrania Acrania CTD_human_DG
★☆☆☆☆
Found in Text Mining only
Acromegaly Acromegaly BEFREE 24092547
★☆☆☆☆
Found in Text Mining only
Acute Coronary Syndrome Coronary Syndrome BEFREE 14637261, 29874658, 30551392
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 21298741
★☆☆☆☆
Found in Text Mining only
Acute monocytic leukemia Monocytic Leukemia BEFREE 25860293
★☆☆☆☆
Found in Text Mining only
Acute pancreatitis Pancreatitis BEFREE 15880317, 16636603, 17940904, 18837094, 19844201, 29511434, 31054479
★☆☆☆☆
Found in Text Mining only
Acute recurrent pancreatitis Pancreatitis BEFREE 19844201
★☆☆☆☆
Found in Text Mining only
Addison Disease Addison`s Disease BEFREE 28765037
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 15900302, 17390111, 21187454, 21356356, 25915587, 26146082, 28946699, 8592656
★☆☆☆☆
Found in Text Mining only