SERPINB4 (serpin family B member 4)

Gene

• Entrez ID: 6318
• Gene name: Serpin family B member 4
• Gene symbol: SERPINB4
• Synonyms (NCBI Gene): LEUPIN, PI11, SCCA-2, SCCA1, SCCA2
• Chromosome: 18
• Chromosome location: 18q21.33
• Summary: The protein encoded by this gene is a member of the serpin family of serine protease inhibitors. The encoded protein is highly expressed in many tumor cells and can inactivate granzyme M, an enzyme that kills tumor cells. This protein, along with serpin B

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT443446	hsa-miR-4517	PAR-CLIP	22100165
MIRT443445	hsa-miR-3123	PAR-CLIP	22100165
MIRT443444	hsa-miR-556-5p	PAR-CLIP	22100165
MIRT443443	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT443446	hsa-miR-4517	PAR-CLIP	22100165
MIRT443445	hsa-miR-3123	PAR-CLIP	22100165
MIRT443444	hsa-miR-556-5p	PAR-CLIP	22100165
MIRT443443	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT2100127	hsa-miR-4263	CLIP-seq
MIRT2100128	hsa-miR-4719	CLIP-seq
MIRT2100129	hsa-miR-4799-5p	CLIP-seq
MIRT2100130	hsa-miR-576-5p	CLIP-seq
MIRT2325020	hsa-miR-4282	CLIP-seq
MIRT2100128	hsa-miR-4719	CLIP-seq
MIRT2620601	hsa-miR-3671	CLIP-seq
MIRT2620602	hsa-miR-607	CLIP-seq
MIRT2620601	hsa-miR-3671	CLIP-seq
MIRT2620602	hsa-miR-607	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002020	Function	Protease binding	IEA
GO:0002020	Function	Protease binding	IPI	21857942
GO:0004866	Function	Endopeptidase inhibitor activity	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IDA	21857942
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	NAS	7589435
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0010466	Process	Negative regulation of peptidase activity	IDA	12949073
GO:0019899	Function	Enzyme binding	IPI	23382074
GO:0030162	Process	Regulation of proteolysis	NAS	7589435
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0042270	Process	Protection from natural killer cell mediated cytotoxicity	IMP	21857942

Other IDs

• MIM: 600518
• HGNC: 10570
• e!Ensembl: ENSG00000206073

Protein

• UniProt ID: P48594
• Protein name: Serpin B4 (Leupin) (Peptidase inhibitor 11) (PI-11) (Squamous cell carcinoma antigen 2) (SCCA-2)
• Protein function: May act as a protease inhibitor to modulate the host immune response against tumor cells.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00079	Serpin	6 → 390	Serpin (serine protease inhibitor)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Squamous cells.
• Sequence:

  MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQISKVLHFD
  QVTENTTEKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYL
  DAIKKFYQTSVESTDFANAPEESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAI
  YFKGQWENKFKKENTKEEKFWPNKNTYKSVQMMRQYNSFNFALLEDVQAKVLEIPYKGKD
  LSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCVDLHLPRFKMEESYDLKDTLR
  TMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAVVVVELSSPSTN
  EEFCCNHPFLFFIRQNKTNSILFYGRFSSP

• Sequence length: 390

Pathways

KEGG:

Amoebiasis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CONTACT DERMATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	11267667, 14647462		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	30825353		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16710347		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	18638391		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	15677460		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	16238792, 23199842, 29642409		★☆☆☆☆ Found in Text Mining only
Bowen's Disease		Pubtator	36085041	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17291250, 17638865	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16710347, 21576355		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	10867615, 21857942, 36085041	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	10873412, 17291250, 18497852, 29112685		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	10873412, 29112685		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	18638391		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	23285167	Associate	★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	39838210	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	28734739	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	16238792, 25111616, 28734739, 29642409, 31378660		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	16238792, 25111616, 28734739, 29642409, 31378660		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	19125792, 30825353		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	19125792, 30825353		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	30825353		★☆☆☆☆ Found in Text Mining only
Fatty Liver, Alcoholic	Alcoholic Fatty Liver	BEFREE	18638391		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	37858084	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	39838210	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	14970861		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18638391, 21576355, 25150316, 25840050, 28766361		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	28766361		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	14970861		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	19125792, 30825353		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	18638391		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16710347, 21576355		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	12702576		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11406281, 17016656, 19125792, 21576355, 30078551		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	16710347		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	10873412, 29112685		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27668655		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27668655, 35085295, 36553569	Associate	★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10653592, 10873412, 11280721, 12702576, 19332150, 25150316, 29112685, 29399402, 30825353		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	33831431	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	14647462		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	25111616, 29642409		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	12702576		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	LHGDN	12702576		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10867615, 11182054, 11267667, 11406281, 14647462, 16006770, 16238792, 20527047, 21274549, 29642409, 30376194		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16211231, 16549498		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16006770, 22922995, 22937809	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	12702576		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16155915, 22937809, 29701125		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17291250	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	29112685	Associate	★☆☆☆☆ Found in Text Mining only