SATB1 (SATB homeobox 1)

Gene

• Entrez ID: 6304
• Gene name: SATB homeobox 1
• Gene symbol: SATB1
• Synonyms (NCBI Gene): DEFDA, DHDBV, KTZSL
• Chromosome: 3
• Chromosome location: 3p24.3
• Summary: This gene encodes a matrix protein which binds nuclear matrix and scaffold-associating DNAs through a unique nuclear architecture. The protein recruits chromatin-remodeling factors in order to regulate chromatin structure and gene expression. [provided by

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005643	hsa-miR-448	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	20798686
MIRT006722	hsa-miR-191-5p	Luciferase reporter assay, qRT-PCR, Western blot	22683624
MIRT006722	hsa-miR-191-5p	Luciferase reporter assay, qRT-PCR, Western blot	23542418
MIRT006722	hsa-miR-191-5p	Luciferase reporter assay, qRT-PCR, Western blot	23542418
MIRT016235	hsa-miR-548b-3p	Sequencing	20371350
MIRT017626	hsa-miR-335-5p	Microarray	18185580
MIRT038509	hsa-miR-296-3p	CLASH	23622248
MIRT052948	hsa-miR-21-5p	qRT-PCR, Western blot	22227207
MIRT006722	hsa-miR-191-5p	Immunoprecipitation, In situ hybridization, Luciferase assay, Microarray, Northern blot, QRTPCR, Western blot	23505378
MIRT607889	hsa-miR-511-3p	HITS-CLIP	24906430
MIRT607888	hsa-miR-581	HITS-CLIP	24906430
MIRT306362	hsa-miR-567	HITS-CLIP	24906430
MIRT608937	hsa-miR-4417	HITS-CLIP	24906430
MIRT607886	hsa-miR-223-5p	HITS-CLIP	24906430
MIRT607885	hsa-miR-3911	HITS-CLIP	24906430
MIRT607884	hsa-miR-644a	HITS-CLIP	24906430
MIRT607883	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT306364	hsa-miR-297	HITS-CLIP	24906430
MIRT608936	hsa-miR-4265	HITS-CLIP	24906430
MIRT608935	hsa-miR-4296	HITS-CLIP	24906430
MIRT608934	hsa-miR-4322	HITS-CLIP	24906430
MIRT607881	hsa-miR-6818-5p	HITS-CLIP	24906430
MIRT607880	hsa-miR-147a	HITS-CLIP	24906430
MIRT607878	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT607889	hsa-miR-511-3p	HITS-CLIP	24906430
MIRT607888	hsa-miR-581	HITS-CLIP	24906430
MIRT306362	hsa-miR-567	HITS-CLIP	24906430
MIRT607887	hsa-miR-636	HITS-CLIP	24906430
MIRT607886	hsa-miR-223-5p	HITS-CLIP	24906430
MIRT607885	hsa-miR-3911	HITS-CLIP	24906430
MIRT607884	hsa-miR-644a	HITS-CLIP	24906430
MIRT607883	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT607882	hsa-miR-3143	HITS-CLIP	24906430
MIRT306364	hsa-miR-297	HITS-CLIP	24906430
MIRT607881	hsa-miR-6818-5p	HITS-CLIP	24906430
MIRT607880	hsa-miR-147a	HITS-CLIP	24906430
MIRT607879	hsa-miR-302c-5p	HITS-CLIP	24906430
MIRT607878	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT005643	hsa-miR-448	PAR-CLIP	21572407
MIRT505791	hsa-miR-153-3p	PAR-CLIP	21572407
MIRT554427	hsa-miR-655-3p	PAR-CLIP	21572407
MIRT554426	hsa-miR-374c-5p	PAR-CLIP	21572407
MIRT505790	hsa-miR-129-5p	PAR-CLIP	21572407
MIRT505789	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT505788	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT505786	hsa-miR-8066	PAR-CLIP	21572407
MIRT554425	hsa-miR-4797-5p	PAR-CLIP	21572407
MIRT505787	hsa-miR-8076	PAR-CLIP	21572407
MIRT554424	hsa-miR-759	PAR-CLIP	21572407
MIRT505785	hsa-miR-4701-5p	PAR-CLIP	21572407
MIRT505784	hsa-miR-588	PAR-CLIP	21572407
MIRT554423	hsa-miR-2054	PAR-CLIP	21572407
MIRT505783	hsa-miR-450b-5p	PAR-CLIP	21572407
MIRT505782	hsa-miR-507	PAR-CLIP	21572407
MIRT505781	hsa-miR-557	PAR-CLIP	21572407
MIRT505780	hsa-miR-3680-3p	PAR-CLIP	21572407
MIRT005643	hsa-miR-448	PAR-CLIP	23446348
MIRT505791	hsa-miR-153-3p	PAR-CLIP	23446348
MIRT505790	hsa-miR-129-5p	PAR-CLIP	23446348
MIRT505789	hsa-miR-19b-3p	PAR-CLIP	23446348
MIRT505788	hsa-miR-19a-3p	PAR-CLIP	23446348
MIRT505786	hsa-miR-8066	PAR-CLIP	23446348
MIRT505787	hsa-miR-8076	PAR-CLIP	23446348
MIRT505785	hsa-miR-4701-5p	PAR-CLIP	23446348
MIRT505784	hsa-miR-588	PAR-CLIP	23446348
MIRT505783	hsa-miR-450b-5p	PAR-CLIP	23446348
MIRT505782	hsa-miR-507	PAR-CLIP	23446348
MIRT505781	hsa-miR-557	PAR-CLIP	23446348
MIRT505780	hsa-miR-3680-3p	PAR-CLIP	23446348
MIRT607880	hsa-miR-147a	HITS-CLIP	27418678
MIRT607880	hsa-miR-147a	HITS-CLIP	27418678
MIRT607880	hsa-miR-147a	HITS-CLIP	27418678
MIRT607886	hsa-miR-223-5p	HITS-CLIP	27418678
MIRT607886	hsa-miR-223-5p	HITS-CLIP	27418678
MIRT607886	hsa-miR-223-5p	HITS-CLIP	27418678
MIRT306364	hsa-miR-297	HITS-CLIP	27418678
MIRT306364	hsa-miR-297	HITS-CLIP	27418678
MIRT607879	hsa-miR-302c-5p	HITS-CLIP	27418678
MIRT607882	hsa-miR-3143	HITS-CLIP	27418678
MIRT607885	hsa-miR-3911	HITS-CLIP	27418678
MIRT607885	hsa-miR-3911	HITS-CLIP	27418678
MIRT608936	hsa-miR-4265	HITS-CLIP	27418678
MIRT608936	hsa-miR-4265	HITS-CLIP	27418678
MIRT608935	hsa-miR-4296	HITS-CLIP	27418678
MIRT608935	hsa-miR-4296	HITS-CLIP	27418678
MIRT608934	hsa-miR-4322	HITS-CLIP	27418678
MIRT608934	hsa-miR-4322	HITS-CLIP	27418678
MIRT608937	hsa-miR-4417	HITS-CLIP	27418678
MIRT608937	hsa-miR-4417	HITS-CLIP	27418678
MIRT607889	hsa-miR-511-3p	HITS-CLIP	27418678
MIRT607889	hsa-miR-511-3p	HITS-CLIP	27418678
MIRT306362	hsa-miR-567	HITS-CLIP	27418678
MIRT306362	hsa-miR-567	HITS-CLIP	27418678
MIRT607878	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT607878	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT607878	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT607878	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT607888	hsa-miR-581	HITS-CLIP	27418678
MIRT607888	hsa-miR-581	HITS-CLIP	27418678
MIRT607888	hsa-miR-581	HITS-CLIP	27418678
MIRT607887	hsa-miR-636	HITS-CLIP	27418678
MIRT607887	hsa-miR-636	HITS-CLIP	27418678
MIRT607887	hsa-miR-636	HITS-CLIP	27418678
MIRT607884	hsa-miR-644a	HITS-CLIP	27418678
MIRT607884	hsa-miR-644a	HITS-CLIP	27418678
MIRT607881	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT607881	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT607881	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT607883	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT607883	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT607883	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT607883	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT732974	hsa-miR-130a-3p	Flow cytometry, Immunohistochemistry (IHC), Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	33324070
MIRT734577	hsa-miR-888-3p	qRT-PCR	33123477
MIRT736068	hsa-miR-100-5p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	32724376
MIRT732974	hsa-miR-130a-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	33324070
MIRT005643	hsa-miR-448	PAR-CLIP	21572407
MIRT505791	hsa-miR-153-3p	PAR-CLIP	21572407
MIRT554427	hsa-miR-655-3p	PAR-CLIP	21572407
MIRT554426	hsa-miR-374c-5p	PAR-CLIP	21572407
MIRT505790	hsa-miR-129-5p	PAR-CLIP	21572407
MIRT505789	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT505788	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT505786	hsa-miR-8066	PAR-CLIP	21572407
MIRT554425	hsa-miR-4797-5p	PAR-CLIP	21572407
MIRT505787	hsa-miR-8076	PAR-CLIP	21572407
MIRT554424	hsa-miR-759	PAR-CLIP	21572407
MIRT505785	hsa-miR-4701-5p	PAR-CLIP	21572407
MIRT505784	hsa-miR-588	PAR-CLIP	21572407
MIRT554423	hsa-miR-2054	PAR-CLIP	21572407
MIRT505783	hsa-miR-450b-5p	PAR-CLIP	21572407
MIRT505782	hsa-miR-507	PAR-CLIP	21572407
MIRT505781	hsa-miR-557	PAR-CLIP	21572407
MIRT505780	hsa-miR-3680-3p	PAR-CLIP	21572407
MIRT005643	hsa-miR-448	PAR-CLIP	23446348
MIRT505791	hsa-miR-153-3p	PAR-CLIP	23446348
MIRT505790	hsa-miR-129-5p	PAR-CLIP	23446348
MIRT505789	hsa-miR-19b-3p	PAR-CLIP	23446348
MIRT505788	hsa-miR-19a-3p	PAR-CLIP	23446348
MIRT505786	hsa-miR-8066	PAR-CLIP	23446348
MIRT505787	hsa-miR-8076	PAR-CLIP	23446348
MIRT505785	hsa-miR-4701-5p	PAR-CLIP	23446348
MIRT505784	hsa-miR-588	PAR-CLIP	23446348
MIRT505783	hsa-miR-450b-5p	PAR-CLIP	23446348
MIRT505782	hsa-miR-507	PAR-CLIP	23446348
MIRT505781	hsa-miR-557	PAR-CLIP	23446348
MIRT505780	hsa-miR-3680-3p	PAR-CLIP	23446348
MIRT1326598	hsa-miR-362-5p	CLIP-seq
MIRT1326599	hsa-miR-374c	CLIP-seq
MIRT1326600	hsa-miR-3910	CLIP-seq
MIRT1326601	hsa-miR-3977	CLIP-seq
MIRT1326602	hsa-miR-412	CLIP-seq
MIRT1326603	hsa-miR-4642	CLIP-seq
MIRT1326604	hsa-miR-500a	CLIP-seq
MIRT1326605	hsa-miR-500b	CLIP-seq
MIRT1326606	hsa-miR-655	CLIP-seq
MIRT1326607	hsa-miR-122	CLIP-seq
MIRT1326608	hsa-miR-3662	CLIP-seq
MIRT1326609	hsa-miR-4302	CLIP-seq
MIRT1326610	hsa-miR-485-3p	CLIP-seq
MIRT1326611	hsa-miR-513a-3p	CLIP-seq
MIRT1326612	hsa-miR-548c-3p	CLIP-seq
MIRT2096995	hsa-miR-4477a	CLIP-seq
MIRT2096996	hsa-miR-4503	CLIP-seq
MIRT2321289	hsa-miR-1297	CLIP-seq
MIRT2321290	hsa-miR-130a	CLIP-seq
MIRT2321291	hsa-miR-130b	CLIP-seq
MIRT2321292	hsa-miR-26a	CLIP-seq
MIRT2321293	hsa-miR-26b	CLIP-seq
MIRT2321294	hsa-miR-301a	CLIP-seq
MIRT2321295	hsa-miR-301b	CLIP-seq
MIRT2321296	hsa-miR-302f	CLIP-seq
MIRT2321297	hsa-miR-3125	CLIP-seq
MIRT2321298	hsa-miR-3591-5p	CLIP-seq
MIRT2321299	hsa-miR-3613-3p	CLIP-seq
MIRT2321300	hsa-miR-3622a-3p	CLIP-seq
MIRT2321301	hsa-miR-3622b-3p	CLIP-seq
MIRT1326598	hsa-miR-362-5p	CLIP-seq
MIRT2321302	hsa-miR-3666	CLIP-seq
MIRT2321303	hsa-miR-376c	CLIP-seq
MIRT2321304	hsa-miR-3916	CLIP-seq
MIRT1326601	hsa-miR-3977	CLIP-seq
MIRT1326602	hsa-miR-412	CLIP-seq
MIRT2321305	hsa-miR-4283	CLIP-seq
MIRT2321306	hsa-miR-4295	CLIP-seq
MIRT2321307	hsa-miR-4465	CLIP-seq
MIRT2321308	hsa-miR-4473	CLIP-seq
MIRT2321309	hsa-miR-4480	CLIP-seq
MIRT2321310	hsa-miR-4489	CLIP-seq
MIRT2321311	hsa-miR-454	CLIP-seq
MIRT2321312	hsa-miR-4671-3p	CLIP-seq
MIRT2321313	hsa-miR-4742-3p	CLIP-seq
MIRT2321314	hsa-miR-4803	CLIP-seq
MIRT2321315	hsa-miR-483-3p	CLIP-seq
MIRT2321316	hsa-miR-498	CLIP-seq
MIRT1326605	hsa-miR-500b	CLIP-seq
MIRT2321317	hsa-miR-501-5p	CLIP-seq
MIRT2321318	hsa-miR-570	CLIP-seq
MIRT2321319	hsa-miR-582-5p	CLIP-seq
MIRT2321320	hsa-miR-622	CLIP-seq
MIRT2321321	hsa-miR-892a	CLIP-seq
MIRT2617553	hsa-miR-1205	CLIP-seq
MIRT2617554	hsa-miR-1224-5p	CLIP-seq
MIRT2617555	hsa-miR-1283	CLIP-seq
MIRT2617556	hsa-miR-1286	CLIP-seq
MIRT2617557	hsa-miR-1322	CLIP-seq
MIRT2321299	hsa-miR-3613-3p	CLIP-seq
MIRT2617558	hsa-miR-4722-5p	CLIP-seq
MIRT2617559	hsa-miR-4751	CLIP-seq
MIRT2617560	hsa-miR-4759	CLIP-seq
MIRT2617553	hsa-miR-1205	CLIP-seq
MIRT2617554	hsa-miR-1224-5p	CLIP-seq
MIRT2617555	hsa-miR-1283	CLIP-seq
MIRT2617556	hsa-miR-1286	CLIP-seq
MIRT2617557	hsa-miR-1322	CLIP-seq
MIRT2690218	hsa-miR-194	CLIP-seq
MIRT2690219	hsa-miR-23a	CLIP-seq
MIRT2690220	hsa-miR-23b	CLIP-seq
MIRT2690221	hsa-miR-23c	CLIP-seq
MIRT2321299	hsa-miR-3613-3p	CLIP-seq
MIRT2617558	hsa-miR-4722-5p	CLIP-seq
MIRT2617559	hsa-miR-4751	CLIP-seq
MIRT2617560	hsa-miR-4759	CLIP-seq
MIRT1326612	hsa-miR-548c-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EZH2	Repression	21232178
FOXP3	Unknown	21743493
TNFAIP3	Unknown	24039598

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15851481, 33513338
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	15851481
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	15851481
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	15851481
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	TAS	1505028
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	18408014, 20126258, 25416956, 32296183, 36950384
GO:0005634	Component	Nucleus	IDA	18408014
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006325	Process	Chromatin organization	IEA
GO:0006325	Process	Chromatin organization	TAS	1505028
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0016363	Component	Nuclear matrix	IEA
GO:0016604	Component	Nuclear body	IDA	33513338
GO:0016605	Component	PML body	IDA	18408014
GO:0016605	Component	PML body	IEA
GO:0031981	Component	Nuclear lumen	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	15851481

Other IDs

• MIM: 602075
• HGNC: 10541
• e!Ensembl: ENSG00000182568

Protein

• UniProt ID: Q01826
• Protein name: DNA-binding protein SATB1 (Special AT-rich sequence-binding protein 1)
• Protein function: Crucial silencing factor contributing to the initiation of X inactivation mediated by Xist RNA that occurs during embryogenesis and in lymphoma (By similarity). Binds to DNA at special AT-rich sequences, the consensus SATB1-binding sequence (CSB
• PDB: 1YSE, 2L1P, 2MW8, 2O49, 2O4A, 3NZL, 3TUO, 6LFF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16534	ULD	72 → 170	Ubiquitin-like oligomerisation domain of SATB	Domain
  PF16557	CUTL	176 → 247	CUT1-like DNA-binding domain of SATB	Domain
  PF02376	CUT	366 → 445	CUT domain	Domain
  PF02376	CUT	489 → 568	CUT domain	Domain
  PF00046	Homeodomain	645 → 702	Homeodomain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed predominantly in thymus. {ECO:0000269|PubMed:1505028}.
• Sequence:

  MDHLNEATQGKEHSEMSNNVSDPKGPPAKIARLEQNGSPLGRGRLGSTGAKMQGVPLKHS
  GHLMKTNLRKGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGY
  SHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLP
  PEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWY
  KHFKKTKDMMVEMDSLSELSQQGANHVNFGQQPVPGNTAEQPPSPAQLSHGSQPSVRTPL
  PNLHPGLVSTPISPQLVNQQLVMAQLLNQQYAVNRLLAQQSLNQQYLNHPPPVSRSMNKP
  LEQQVSTNTEVSSEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTASQ
  SLLVNLRAMQNFLQLPEAERDRIYQDERERSLNAASAMGPAPLISTPPSRPPQVKTATIA
  TERNGKPENNTMNINASIYDEIQQEMKRAKVSQALFAKVAATKSQGWLCELLRWKEDPSP
  ENRTLWENLSMIRRFLSLPQPERDAIYEQESNAVHHHGDRPPHIIHVPAEQIQQQQQQQQ
  QQQQQQQAPPPPQPQQQPQTGPRLPPRQPTVASPAESDEENRQKTRPRTKISVEALGILQ
  SFIQDVGLYPDEEAIQTLSAQLDLPKYTIIKFFQNQRYYLKHHGKLKDNSGLEVDVAEYK
  EEELLKDLEESVQDKNTNTLFSVKLEEELSVEGNTDINTDLKD

• Sequence length: 763

Pathways

Reactome:

Apoptotic cleavage of cellular proteins
SUMOylation of chromatin organization proteins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Developmental delay with dysmorphic facies and dental anomalies	Pathogenic; Likely pathogenic	rs1696356078, rs1694228284, rs2125208683, rs752755275, rs2470791087, rs2470798662, rs2470655524, rs2470394817, rs2470652113, rs1575135380	RCV001347718 RCV001347721 RCV002246337 RCV002468650 RCV002468776 RCV003148465 RCV003314137 RCV003326199 RCV003444492 RCV001838246	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Kohlschutter-Tonz syndrome-like	Likely pathogenic; Pathogenic	rs1694399198, rs1696356628, rs1695858904, rs2125208683, rs1213484295, rs2470656351, rs2470392910, rs1291314034	RCV001347719 RCV001347722 RCV001347724 RCV001358692 RCV005622170 RCV003123289 RCV003224967 RCV001347723	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neurodevelopmental delay	Pathogenic	rs2125122990	RCV002274417	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder	Likely pathogenic	rs2125123704	RCV002277664	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism spectrum disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	ClinGen, GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEN HOED-DE BOER-VOISIN SYNDROME	—	Disgenet, HPO Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUCHENNE MUSCULAR DYSTROPHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALDOSTERONISM, FAMILIAL, TYPE II	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY-EPILEPSY-DENTAL ANOMALIES-FACIAL DYSMORPHISM SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SATB1-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SATB1-related neurodevelopmental disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	31130823		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	29374696, 30774380, 31290787, 31708689, 31737131		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	31290787		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	27602772		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	31290787		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	24009715		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	26678884		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	31906708	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	20522714	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	23317753		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	34615535	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29388727		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23076250		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	23642278		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23696028, 25706386, 29079132		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	33974229	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	28049521		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19072498, 20541537, 20595686, 20980149, 21597389, 21743493, 22771615, 23516037, 23542418, 23686316, 24971456, 25586771, 25956130, 25966097, 26678884, 27697109, 28521398, 28927120, 30576489, 9548713		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	20980149, 21597389, 23505378, 25956130, 25966097, 26315726, 27590341, 27697109, 29936452, 32562536, 35611599	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26678884	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23326301, 24260116, 26108419	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23642278		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	22424533, 24497139, 26512778	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26678884	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30539830, 32862579	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23696028, 25706386, 29079132		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21597389, 27179949, 28990092		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24835085, 26097552, 33285627	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21597389	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	25706386	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30132561		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Hypertrophic, Familial	Cardiomyopathy	BEFREE	24714607		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30774380		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30774380		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35529254	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	30142547		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	24714607		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21870058, 24729451, 30742943		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21870058, 22935204, 23326301, 24729451, 24971456, 25543122, 25874491, 26165840, 26701851, 26810818, 27466515, 29867574, 31290787		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22935204, 23326301, 25323550, 25874491, 26810818, 30320357	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24835085, 26097552, 27107063		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	24392879		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	12483038		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	33513338	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29506055		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	24497139		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	12483038		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29467441, 29725375		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	20522714	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28147311, 28521398		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28147311, 28521398		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28147311	Associate	★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	24291816		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	25896016		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	25326863	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	28636989		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23076250, 28049521, 30140041, 30675243		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24176859	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23076250, 24176859, 28049521, 30140041, 30675243		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22839214, 24176859, 24370885, 31564901		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24176859, 37540226	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	33912135	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	32562536	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	24009715		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	24009715, 39195213	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	29510190	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	32771472	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	27992401		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	25326863	Inhibit	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	25323550	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	26563145		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	29936452		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	32174248	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	24291816	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33527899, 34516354	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	18408014	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	17694175, 28179318, 31130823		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	26678884, 31130823		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22088470, 22583549, 25762622, 30539830		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	22583549, 30539830		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	21597389	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21597389	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	24039598	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24047082, 26810818	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25966097	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	30774380		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	24747435	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	31130823, 31450715		★☆☆☆☆ Found in Text Mining only
Lymphoma Primary Cutaneous Anaplastic Large Cell	Primary cutaneous anaplastic large cell lymphoma	Pubtator	29510190, 30032787	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	29751003, 30032787		★☆☆☆☆ Found in Text Mining only
Lymphomatoid Papulosis	Lymphomatoid Papulosis	BEFREE	29510190, 31577659		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	24747435, 29510190		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	24747435, 29510190, 32771472	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	24176859, 30140041		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19072498, 19860849, 20541537, 20595686, 20980149, 21597389, 21743493, 22771615, 23516037, 23542418, 23686316, 24971456, 25586771, 25956130, 25966097, 26678884, 27697109, 28521398, 28927120, 30576489, 9548713		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29467441		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28147311, 28521398		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	28430598		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22583549, 26678884, 31147803		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21597389, 27179949, 28990092		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30132561		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26108419, 28990092, 30337520		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23308245, 23642278, 26084613, 28454436, 29151908, 29374696, 29599837, 31165705		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20811679, 23188721, 24675979, 30349314, 30368875, 31737131		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23696028, 25706386, 29079132		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18337816, 22935204, 22998183, 23251624, 23317753, 23326301, 23642278, 23696028, 24047082, 24176859, 24497139, 25543122, 26108419, 26165840, 26678884, 26876172, 27466515, 29079132, 29344188, 29374696, 29381393, 29546272, 29772444, 30413763, 30539830, 30774380, 30803026, 31130823, 31290787, 31450715		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30774380		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30742943		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18337816, 19072498, 19860849		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	19072498		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	26678884	Stimulate	★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	23642278		★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	31290787		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	22864778, 29751003, 32771472	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	23223620, 24047082, 24696710, 24966956, 30720170, 31497998		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	23223620	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	24047082, 24696710, 24966956, 30720170, 31497998, 33390772	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	23223620	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18337816, 19072498, 20980149, 21870058, 22583549, 22771615, 22839214, 22935204, 22972305, 23076250, 23308245, 23326301, 23437226, 23686316, 23696028, 24176859, 24370885, 24497139, 24729451, 24971456, 25619478, 25874491, 25956130, 26097552, 26108419, 26165840, 26678884, 26876172, 27107063, 28049521, 28345457, 28636989, 28990092, 29079132, 29306014, 29344188, 29381393, 29546272, 29725375, 29772444, 30337520, 30413763, 30539830, 30557545, 31130823, 31147803		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	24966956		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29374696		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	23516037, 25317073, 25619478, 30085330		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	25317073	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26876172, 30132561		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26108419, 28990092, 30337520		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25323550	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26108419	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31543366		★☆☆☆☆ Found in Text Mining only
Primary Cutaneous Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	29510190, 31577659		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23308245, 23642278, 26084613, 28454436, 29151908, 29374696, 29599837, 31165705		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22808207, 23642278, 27966447, 34961766	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	23308245		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	21870058, 22935204, 26528635		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24835085		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	23686316		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	21270445, 29334836		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	21270445	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21597389, 27783844, 29374696		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25951709, 28345457, 29344188		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32174248	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	24260116		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20811679, 23188721, 24675979, 30349314, 30368875, 31737131		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25326863, 27338049, 31737131, 33374770, 36522839	Associate	★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	30803026		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	25706386		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23696028	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25706386, 33285627	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	30082769	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	24291816		★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	24747435	Associate	★☆☆☆☆ Found in Text Mining only