Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6303
Gene name	Spermidine/spermine N1-acetyltransferase 1
Gene symbol	SAT1
Synonyms (NCBI Gene)	DC21KFSDKFSDXSATSSATSSAT-1
Chromosome	X
Chromosome location	Xp22.11
Summary	The protein encoded by this gene belongs to the acetyltransferase family, and is a rate-limiting enzyme in the catabolic pathway of polyamine metabolism. It catalyzes the acetylation of spermidine and spermine, and is involved in the regulation of the int

125

Show/Hide all (125)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019180	hsa-miR-335-5p	Microarray	18185580
MIRT026968	hsa-miR-107	Microarray	20489155
MIRT048548	hsa-miR-100-5p	CLASH	23622248
MIRT039551	hsa-miR-652-3p	CLASH	23622248
MIRT037883	hsa-miR-455-3p	CLASH	23622248
MIRT037497	hsa-miR-744-5p	CLASH	23622248
MIRT504006	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT504005	hsa-miR-551b-5p	PAR-CLIP	21572407
MIRT504004	hsa-miR-1244	PAR-CLIP	21572407
MIRT504003	hsa-miR-4477a	PAR-CLIP	21572407
MIRT504006	hsa-miR-186-5p	PAR-CLIP	23446348
MIRT504005	hsa-miR-551b-5p	PAR-CLIP	23446348
MIRT504004	hsa-miR-1244	PAR-CLIP	23446348
MIRT504003	hsa-miR-4477a	PAR-CLIP	23446348
MIRT504006	hsa-miR-186-5p	PAR-CLIP	23446348
MIRT504005	hsa-miR-551b-5p	PAR-CLIP	23446348
MIRT504004	hsa-miR-1244	PAR-CLIP	23446348
MIRT504003	hsa-miR-4477a	PAR-CLIP	23446348
MIRT504006	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT504005	hsa-miR-551b-5p	PAR-CLIP	21572407
MIRT504004	hsa-miR-1244	PAR-CLIP	21572407
MIRT504003	hsa-miR-4477a	PAR-CLIP	21572407
MIRT504006	hsa-miR-186-5p	PAR-CLIP	23446348
MIRT504005	hsa-miR-551b-5p	PAR-CLIP	23446348
MIRT504004	hsa-miR-1244	PAR-CLIP	23446348
MIRT504003	hsa-miR-4477a	PAR-CLIP	23446348
MIRT504006	hsa-miR-186-5p	PAR-CLIP	23446348
MIRT504005	hsa-miR-551b-5p	PAR-CLIP	23446348
MIRT504004	hsa-miR-1244	PAR-CLIP	23446348
MIRT504003	hsa-miR-4477a	PAR-CLIP	23446348
MIRT1326586	hsa-miR-1283	CLIP-seq
MIRT1326587	hsa-miR-186	CLIP-seq
MIRT1326588	hsa-miR-199a-5p	CLIP-seq
MIRT1326589	hsa-miR-199b-5p	CLIP-seq
MIRT1326590	hsa-miR-3177-5p	CLIP-seq
MIRT1326591	hsa-miR-3907	CLIP-seq
MIRT1326592	hsa-miR-4259	CLIP-seq
MIRT1326593	hsa-miR-4302	CLIP-seq
MIRT1326594	hsa-miR-4506	CLIP-seq
MIRT1326595	hsa-miR-451b	CLIP-seq
MIRT1326596	hsa-miR-4795-3p	CLIP-seq
MIRT1326597	hsa-miR-618	CLIP-seq
MIRT1326586	hsa-miR-1283	CLIP-seq
MIRT2321277	hsa-miR-4252	CLIP-seq
MIRT1326592	hsa-miR-4259	CLIP-seq
MIRT2321278	hsa-miR-4425	CLIP-seq
MIRT1326595	hsa-miR-451b	CLIP-seq
MIRT1326596	hsa-miR-4795-3p	CLIP-seq
MIRT2321279	hsa-miR-607	CLIP-seq
MIRT2321277	hsa-miR-4252	CLIP-seq
MIRT2321279	hsa-miR-607	CLIP-seq
MIRT2617526	hsa-miR-1	CLIP-seq
MIRT1326586	hsa-miR-1283	CLIP-seq
MIRT2617527	hsa-miR-139-5p	CLIP-seq
MIRT1326588	hsa-miR-199a-5p	CLIP-seq
MIRT1326589	hsa-miR-199b-5p	CLIP-seq
MIRT2617528	hsa-miR-206	CLIP-seq
MIRT2617529	hsa-miR-217	CLIP-seq
MIRT2617530	hsa-miR-3064-3p	CLIP-seq
MIRT2617531	hsa-miR-3121-3p	CLIP-seq
MIRT2617532	hsa-miR-3156-5p	CLIP-seq
MIRT1326590	hsa-miR-3177-5p	CLIP-seq
MIRT2617533	hsa-miR-3200-5p	CLIP-seq
MIRT2617534	hsa-miR-320a	CLIP-seq
MIRT2617535	hsa-miR-320b	CLIP-seq
MIRT2617536	hsa-miR-320c	CLIP-seq
MIRT2617537	hsa-miR-320d	CLIP-seq
MIRT2617538	hsa-miR-323b-5p	CLIP-seq
MIRT2617539	hsa-miR-3673	CLIP-seq
MIRT2617540	hsa-miR-3689d	CLIP-seq
MIRT1326591	hsa-miR-3907	CLIP-seq
MIRT2617541	hsa-miR-4251	CLIP-seq
MIRT2321277	hsa-miR-4252	CLIP-seq
MIRT1326592	hsa-miR-4259	CLIP-seq
MIRT2617542	hsa-miR-4272	CLIP-seq
MIRT1326593	hsa-miR-4302	CLIP-seq
MIRT2617543	hsa-miR-4329	CLIP-seq
MIRT2321278	hsa-miR-4425	CLIP-seq
MIRT2617544	hsa-miR-4428	CLIP-seq
MIRT2617545	hsa-miR-4429	CLIP-seq
MIRT2617546	hsa-miR-4490	CLIP-seq
MIRT1326594	hsa-miR-4506	CLIP-seq
MIRT1326595	hsa-miR-451b	CLIP-seq
MIRT2617547	hsa-miR-4522	CLIP-seq
MIRT2617548	hsa-miR-4715-3p	CLIP-seq
MIRT1326596	hsa-miR-4795-3p	CLIP-seq
MIRT2617549	hsa-miR-4799-5p	CLIP-seq
MIRT2617550	hsa-miR-4802-5p	CLIP-seq
MIRT2617551	hsa-miR-515-5p	CLIP-seq
MIRT2321279	hsa-miR-607	CLIP-seq
MIRT2617552	hsa-miR-613	CLIP-seq
MIRT1326597	hsa-miR-618	CLIP-seq
MIRT2617526	hsa-miR-1	CLIP-seq
MIRT1326586	hsa-miR-1283	CLIP-seq
MIRT2617527	hsa-miR-139-5p	CLIP-seq
MIRT2617528	hsa-miR-206	CLIP-seq
MIRT2617529	hsa-miR-217	CLIP-seq
MIRT2617530	hsa-miR-3064-3p	CLIP-seq
MIRT2617531	hsa-miR-3121-3p	CLIP-seq
MIRT2617533	hsa-miR-3200-5p	CLIP-seq
MIRT2617534	hsa-miR-320a	CLIP-seq
MIRT2617535	hsa-miR-320b	CLIP-seq
MIRT2617536	hsa-miR-320c	CLIP-seq
MIRT2617537	hsa-miR-320d	CLIP-seq
MIRT2617538	hsa-miR-323b-5p	CLIP-seq
MIRT2617539	hsa-miR-3673	CLIP-seq
MIRT2617540	hsa-miR-3689d	CLIP-seq
MIRT1326591	hsa-miR-3907	CLIP-seq
MIRT2617541	hsa-miR-4251	CLIP-seq
MIRT2321277	hsa-miR-4252	CLIP-seq
MIRT1326592	hsa-miR-4259	CLIP-seq
MIRT2617543	hsa-miR-4329	CLIP-seq
MIRT2321278	hsa-miR-4425	CLIP-seq
MIRT2617545	hsa-miR-4429	CLIP-seq
MIRT2617546	hsa-miR-4490	CLIP-seq
MIRT1326594	hsa-miR-4506	CLIP-seq
MIRT1326595	hsa-miR-451b	CLIP-seq
MIRT2617547	hsa-miR-4522	CLIP-seq
MIRT2617548	hsa-miR-4715-3p	CLIP-seq
MIRT1326596	hsa-miR-4795-3p	CLIP-seq
MIRT2617549	hsa-miR-4799-5p	CLIP-seq
MIRT2617550	hsa-miR-4802-5p	CLIP-seq
MIRT2617551	hsa-miR-515-5p	CLIP-seq
MIRT2321279	hsa-miR-607	CLIP-seq
MIRT2617552	hsa-miR-613	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
PPARD	Activation	14506281
PPARG	Activation	14506281
PPARG	Unknown	14750214

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEP	11866539
GO:0004145	Function	Diamine N-acetyltransferase activity	IBA
GO:0004145	Function	Diamine N-acetyltransferase activity	IDA	15283699
GO:0004145	Function	Diamine N-acetyltransferase activity	IEA
GO:0004145	Function	Diamine N-acetyltransferase activity	TAS	1985966
GO:0005515	Function	Protein binding	IPI	16169070, 16189514, 19060904, 21516116, 25416956, 29892012, 31515488, 32296183, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006596	Process	Polyamine biosynthetic process	IDA	15283699
GO:0006596	Process	Polyamine biosynthetic process	TAS
GO:0008080	Function	N-acetyltransferase activity	IDA	15283699
GO:0009447	Process	Putrescine catabolic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016747	Function	Acyltransferase activity, transferring groups other than amino-acyl groups	IEA
GO:0019809	Function	Spermidine binding	IBA
GO:0032918	Process	Spermidine acetylation	IBA
GO:0032918	Process	Spermidine acetylation	IDA	15283699
GO:0032918	Process	Spermidine acetylation	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042802	Function	Identical protein binding	IPI	16189514, 16455797, 25416956

MIM	HGNC	e!Ensembl
313020	10540	ENSG00000130066

P21673

Protein name

Diamine acetyltransferase 1 (EC 2.3.1.57) (Polyamine N-acetyltransferase 1) (Putrescine acetyltransferase) (Spermidine/spermine N(1)-acetyltransferase 1) (SSAT) (SSAT-1)

Protein function

Enzyme which catalyzes the acetylation of polyamines (PubMed:15283699, PubMed:16455797, PubMed:17516632). Substrate specificity: norspermidine = spermidine >> spermine > N(1)-acetylspermine (PubMed:17516632). This highly regulated enzyme allows

PDB

2B3U , 2B3V , 2B4B , 2B4D , 2B58 , 2B5G , 2F5I , 2FXF , 2G3T , 2JEV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00583	Acetyltransf_1	14 → 145	Acetyltransferase (GNAT) family	Family

Sequence

MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVP
KEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRC
RCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE

Sequence length

171

Interactions

View interactions

	KEGG		Reactome
	Arginine and proline metabolism Metabolic pathways Ferroptosis		Interconversion of polyamines

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANXIETY DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATOSIS FOLLICULARIS SPINULOSA DECALVANS	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOAFFECTIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS OF CHILDHOOD	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

SAT1 (spermidine/spermine N1-acetyltransferase 1)