SAA4 (serum amyloid A4, constitutive)

Gene

• Entrez ID: 6291
• Gene name: Serum amyloid A4, constitutive
• Gene symbol: SAA4
• Synonyms (NCBI Gene): C-SAA, CSAA
• Chromosome: 11
• Chromosome location: 11p15.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1324598	hsa-miR-1343	CLIP-seq
MIRT1324599	hsa-miR-3144-5p	CLIP-seq
MIRT1324600	hsa-miR-3191	CLIP-seq
MIRT1324601	hsa-miR-4652-5p	CLIP-seq
MIRT1324602	hsa-miR-4667-5p	CLIP-seq
MIRT1324603	hsa-miR-4700-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0006953	Process	Acute-phase response	IEA
GO:0034364	Component	High-density lipoprotein particle	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145

Other IDs

• MIM: 104752
• HGNC: 10516
• e!Ensembl: ENSG00000148965

Protein

• UniProt ID: P35542
• Protein name: Serum amyloid A-4 protein (Constitutively expressed serum amyloid A protein) (C-SAA)
• Protein function: Major acute phase reactant.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00277	SAA	22 → 130	Serum amyloid A protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed by the liver; secreted in plasma.
• Sequence:

  MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNY
  DAAQRGPGGVWAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDR
  FRPDGLPKKY

• Sequence length: 130

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
AA amyloidosis	AA amyloidosis	BEFREE	20536400		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	20536400		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28505104	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30662913	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16116035		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	38300370	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25220188		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	37653176	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20713982		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17849429		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20713982	Stimulate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	27531006	Associate	★☆☆☆☆ Found in Text Mining only
Reactive systemic amyloidosis	Reactive Systemic Amyloidosis	BEFREE	20536400		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28505104		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23631828	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24447576	Stimulate	★☆☆☆☆ Found in Text Mining only