S100A11 (S100 calcium binding protein A11)

Gene

• Entrez ID: 6282
• Gene name: S100 calcium binding protein A11
• Gene symbol: S100A11
• Synonyms (NCBI Gene): HEL-S-43, MLN70, S100C
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020889	hsa-miR-155-5p	Proteomics	18668040
MIRT023889	hsa-miR-1-3p	Proteomics	18668040
MIRT460531	hsa-miR-548az-5p	HITS-CLIP	23706177
MIRT460530	hsa-miR-548t-5p	HITS-CLIP	23706177
MIRT460529	hsa-miR-3609	HITS-CLIP	23706177
MIRT460528	hsa-miR-548ah-5p	HITS-CLIP	23706177
MIRT460527	hsa-miR-4307	HITS-CLIP	23706177
MIRT460526	hsa-miR-556-3p	HITS-CLIP	23706177
MIRT460525	hsa-miR-6516-3p	HITS-CLIP	23706177
MIRT500058	hsa-miR-648	PAR-CLIP	24398324
MIRT500057	hsa-miR-7854-3p	PAR-CLIP	24398324
MIRT500056	hsa-miR-6134	PAR-CLIP	24398324
MIRT500055	hsa-miR-6076	PAR-CLIP	24398324
MIRT500054	hsa-miR-6797-3p	PAR-CLIP	24398324
MIRT500053	hsa-miR-3934-3p	PAR-CLIP	24398324
MIRT500052	hsa-miR-876-3p	PAR-CLIP	24398324
MIRT500051	hsa-miR-142-3p	PAR-CLIP	24398324
MIRT500050	hsa-miR-3591-5p	PAR-CLIP	24398324
MIRT460531	hsa-miR-548az-5p	PAR-CLIP	23592263
MIRT460530	hsa-miR-548t-5p	PAR-CLIP	23592263
MIRT460529	hsa-miR-3609	PAR-CLIP	23592263
MIRT460528	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT460527	hsa-miR-4307	PAR-CLIP	23592263
MIRT460526	hsa-miR-556-3p	PAR-CLIP	23592263
MIRT460525	hsa-miR-6516-3p	PAR-CLIP	23592263
MIRT439718	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439718	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT500051	hsa-miR-142-3p	PAR-CLIP	27292025
MIRT500050	hsa-miR-3591-5p	PAR-CLIP	27292025
MIRT460529	hsa-miR-3609	PAR-CLIP	27292025
MIRT500053	hsa-miR-3934-3p	PAR-CLIP	27292025
MIRT460527	hsa-miR-4307	PAR-CLIP	27292025
MIRT460528	hsa-miR-548ah-5p	PAR-CLIP	27292025
MIRT460531	hsa-miR-548az-5p	PAR-CLIP	27292025
MIRT460530	hsa-miR-548t-5p	PAR-CLIP	27292025
MIRT460526	hsa-miR-556-3p	PAR-CLIP	27292025
MIRT500055	hsa-miR-6076	PAR-CLIP	27292025
MIRT500056	hsa-miR-6134	PAR-CLIP	27292025
MIRT500058	hsa-miR-648	PAR-CLIP	27292025
MIRT460525	hsa-miR-6516-3p	PAR-CLIP	27292025
MIRT500054	hsa-miR-6797-3p	PAR-CLIP	27292025
MIRT500057	hsa-miR-7854-3p	PAR-CLIP	27292025
MIRT500052	hsa-miR-876-3p	PAR-CLIP	27292025
MIRT460531	hsa-miR-548az-5p	HITS-CLIP	23706177
MIRT460530	hsa-miR-548t-5p	HITS-CLIP	23706177
MIRT460529	hsa-miR-3609	HITS-CLIP	23706177
MIRT460528	hsa-miR-548ah-5p	HITS-CLIP	23706177
MIRT460527	hsa-miR-4307	HITS-CLIP	23706177
MIRT460526	hsa-miR-556-3p	HITS-CLIP	23706177
MIRT460525	hsa-miR-6516-3p	HITS-CLIP	23706177
MIRT500058	hsa-miR-648	PAR-CLIP	24398324
MIRT500057	hsa-miR-7854-3p	PAR-CLIP	24398324
MIRT500056	hsa-miR-6134	PAR-CLIP	24398324
MIRT500055	hsa-miR-6076	PAR-CLIP	24398324
MIRT500054	hsa-miR-6797-3p	PAR-CLIP	24398324
MIRT500053	hsa-miR-3934-3p	PAR-CLIP	24398324
MIRT500052	hsa-miR-876-3p	PAR-CLIP	24398324
MIRT500051	hsa-miR-142-3p	PAR-CLIP	24398324
MIRT500050	hsa-miR-3591-5p	PAR-CLIP	24398324
MIRT460531	hsa-miR-548az-5p	PAR-CLIP	23592263
MIRT460530	hsa-miR-548t-5p	PAR-CLIP	23592263
MIRT460529	hsa-miR-3609	PAR-CLIP	23592263
MIRT460528	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT460527	hsa-miR-4307	PAR-CLIP	23592263
MIRT460526	hsa-miR-556-3p	PAR-CLIP	23592263
MIRT460525	hsa-miR-6516-3p	PAR-CLIP	23592263
MIRT1323852	hsa-miR-1252	CLIP-seq
MIRT1323853	hsa-miR-1266	CLIP-seq
MIRT1323854	hsa-miR-1270	CLIP-seq
MIRT1323855	hsa-miR-1272	CLIP-seq
MIRT1323856	hsa-miR-1293	CLIP-seq
MIRT1323857	hsa-miR-143	CLIP-seq
MIRT1323858	hsa-miR-1587	CLIP-seq
MIRT1323859	hsa-miR-2861	CLIP-seq
MIRT1323860	hsa-miR-3151	CLIP-seq
MIRT1323861	hsa-miR-3202	CLIP-seq
MIRT1323862	hsa-miR-3652	CLIP-seq
MIRT1323863	hsa-miR-3918	CLIP-seq
MIRT1323864	hsa-miR-3936	CLIP-seq
MIRT1323865	hsa-miR-4417	CLIP-seq
MIRT1323866	hsa-miR-4430	CLIP-seq
MIRT1323867	hsa-miR-4483	CLIP-seq
MIRT1323868	hsa-miR-4492	CLIP-seq
MIRT1323869	hsa-miR-4493	CLIP-seq
MIRT1323870	hsa-miR-4498	CLIP-seq
MIRT1323871	hsa-miR-4518	CLIP-seq
MIRT1323872	hsa-miR-4533	CLIP-seq
MIRT1323873	hsa-miR-4651	CLIP-seq
MIRT1323874	hsa-miR-4656	CLIP-seq
MIRT1323875	hsa-miR-4675	CLIP-seq
MIRT1323876	hsa-miR-4683	CLIP-seq
MIRT1323877	hsa-miR-4685-5p	CLIP-seq
MIRT1323878	hsa-miR-4741	CLIP-seq
MIRT1323879	hsa-miR-4753-5p	CLIP-seq
MIRT1323880	hsa-miR-4770	CLIP-seq
MIRT1323881	hsa-miR-541	CLIP-seq
MIRT1323882	hsa-miR-548ah	CLIP-seq
MIRT1323883	hsa-miR-548t	CLIP-seq
MIRT1323884	hsa-miR-608	CLIP-seq
MIRT1323885	hsa-miR-615-5p	CLIP-seq
MIRT1323886	hsa-miR-620	CLIP-seq
MIRT1323887	hsa-miR-629	CLIP-seq
MIRT1323888	hsa-miR-654-5p	CLIP-seq
MIRT1323889	hsa-miR-762	CLIP-seq
MIRT1323852	hsa-miR-1252	CLIP-seq
MIRT1323854	hsa-miR-1270	CLIP-seq
MIRT1323855	hsa-miR-1272	CLIP-seq
MIRT1323857	hsa-miR-143	CLIP-seq
MIRT1323858	hsa-miR-1587	CLIP-seq
MIRT1323861	hsa-miR-3202	CLIP-seq
MIRT1323862	hsa-miR-3652	CLIP-seq
MIRT1323866	hsa-miR-4430	CLIP-seq
MIRT1323868	hsa-miR-4492	CLIP-seq
MIRT1323870	hsa-miR-4498	CLIP-seq
MIRT1323872	hsa-miR-4533	CLIP-seq
MIRT1323873	hsa-miR-4651	CLIP-seq
MIRT1323874	hsa-miR-4656	CLIP-seq
MIRT1323875	hsa-miR-4675	CLIP-seq
MIRT1323876	hsa-miR-4683	CLIP-seq
MIRT1323878	hsa-miR-4741	CLIP-seq
MIRT1323880	hsa-miR-4770	CLIP-seq
MIRT1323884	hsa-miR-608	CLIP-seq
MIRT1323886	hsa-miR-620	CLIP-seq
MIRT1323887	hsa-miR-629	CLIP-seq
MIRT1323889	hsa-miR-762	CLIP-seq
MIRT1323852	hsa-miR-1252	CLIP-seq
MIRT1323853	hsa-miR-1266	CLIP-seq
MIRT1323854	hsa-miR-1270	CLIP-seq
MIRT1323855	hsa-miR-1272	CLIP-seq
MIRT1323856	hsa-miR-1293	CLIP-seq
MIRT1323857	hsa-miR-143	CLIP-seq
MIRT1323858	hsa-miR-1587	CLIP-seq
MIRT1323859	hsa-miR-2861	CLIP-seq
MIRT1323860	hsa-miR-3151	CLIP-seq
MIRT1323861	hsa-miR-3202	CLIP-seq
MIRT1323862	hsa-miR-3652	CLIP-seq
MIRT1323863	hsa-miR-3918	CLIP-seq
MIRT1323864	hsa-miR-3936	CLIP-seq
MIRT1323865	hsa-miR-4417	CLIP-seq
MIRT1323866	hsa-miR-4430	CLIP-seq
MIRT1323867	hsa-miR-4483	CLIP-seq
MIRT1323868	hsa-miR-4492	CLIP-seq
MIRT1323869	hsa-miR-4493	CLIP-seq
MIRT1323870	hsa-miR-4498	CLIP-seq
MIRT1323871	hsa-miR-4518	CLIP-seq
MIRT1323872	hsa-miR-4533	CLIP-seq
MIRT1323873	hsa-miR-4651	CLIP-seq
MIRT1323874	hsa-miR-4656	CLIP-seq
MIRT1323875	hsa-miR-4675	CLIP-seq
MIRT1323876	hsa-miR-4683	CLIP-seq
MIRT1323877	hsa-miR-4685-5p	CLIP-seq
MIRT1323878	hsa-miR-4741	CLIP-seq
MIRT1323879	hsa-miR-4753-5p	CLIP-seq
MIRT1323880	hsa-miR-4770	CLIP-seq
MIRT1323881	hsa-miR-541	CLIP-seq
MIRT1323882	hsa-miR-548ah	CLIP-seq
MIRT1323883	hsa-miR-548t	CLIP-seq
MIRT1323884	hsa-miR-608	CLIP-seq
MIRT1323886	hsa-miR-620	CLIP-seq
MIRT1323887	hsa-miR-629	CLIP-seq
MIRT1323888	hsa-miR-654-5p	CLIP-seq
MIRT1323889	hsa-miR-762	CLIP-seq
MIRT1323852	hsa-miR-1252	CLIP-seq
MIRT1323853	hsa-miR-1266	CLIP-seq
MIRT1323854	hsa-miR-1270	CLIP-seq
MIRT1323855	hsa-miR-1272	CLIP-seq
MIRT1323856	hsa-miR-1293	CLIP-seq
MIRT1323857	hsa-miR-143	CLIP-seq
MIRT1323858	hsa-miR-1587	CLIP-seq
MIRT1323859	hsa-miR-2861	CLIP-seq
MIRT1323860	hsa-miR-3151	CLIP-seq
MIRT1323861	hsa-miR-3202	CLIP-seq
MIRT1323862	hsa-miR-3652	CLIP-seq
MIRT1323863	hsa-miR-3918	CLIP-seq
MIRT1323864	hsa-miR-3936	CLIP-seq
MIRT1323865	hsa-miR-4417	CLIP-seq
MIRT1323866	hsa-miR-4430	CLIP-seq
MIRT1323867	hsa-miR-4483	CLIP-seq
MIRT1323868	hsa-miR-4492	CLIP-seq
MIRT1323869	hsa-miR-4493	CLIP-seq
MIRT1323870	hsa-miR-4498	CLIP-seq
MIRT1323871	hsa-miR-4518	CLIP-seq
MIRT1323872	hsa-miR-4533	CLIP-seq
MIRT1323873	hsa-miR-4651	CLIP-seq
MIRT1323874	hsa-miR-4656	CLIP-seq
MIRT1323875	hsa-miR-4675	CLIP-seq
MIRT1323876	hsa-miR-4683	CLIP-seq
MIRT1323877	hsa-miR-4685-5p	CLIP-seq
MIRT1323878	hsa-miR-4741	CLIP-seq
MIRT1323879	hsa-miR-4753-5p	CLIP-seq
MIRT1323880	hsa-miR-4770	CLIP-seq
MIRT1323881	hsa-miR-541	CLIP-seq
MIRT1323882	hsa-miR-548ah	CLIP-seq
MIRT1323883	hsa-miR-548t	CLIP-seq
MIRT1323884	hsa-miR-608	CLIP-seq
MIRT1323886	hsa-miR-620	CLIP-seq
MIRT1323887	hsa-miR-629	CLIP-seq
MIRT1323888	hsa-miR-654-5p	CLIP-seq
MIRT1323889	hsa-miR-762	CLIP-seq
MIRT1323853	hsa-miR-1266	CLIP-seq
MIRT1323854	hsa-miR-1270	CLIP-seq
MIRT1323855	hsa-miR-1272	CLIP-seq
MIRT1323856	hsa-miR-1293	CLIP-seq
MIRT1323857	hsa-miR-143	CLIP-seq
MIRT1323858	hsa-miR-1587	CLIP-seq
MIRT1323859	hsa-miR-2861	CLIP-seq
MIRT1323860	hsa-miR-3151	CLIP-seq
MIRT1323865	hsa-miR-4417	CLIP-seq
MIRT1323867	hsa-miR-4483	CLIP-seq
MIRT1323868	hsa-miR-4492	CLIP-seq
MIRT1323870	hsa-miR-4498	CLIP-seq
MIRT1323871	hsa-miR-4518	CLIP-seq
MIRT1323874	hsa-miR-4656	CLIP-seq
MIRT1323875	hsa-miR-4675	CLIP-seq
MIRT1323876	hsa-miR-4683	CLIP-seq
MIRT1323878	hsa-miR-4741	CLIP-seq
MIRT1323880	hsa-miR-4770	CLIP-seq
MIRT1323881	hsa-miR-541	CLIP-seq
MIRT1323886	hsa-miR-620	CLIP-seq
MIRT1323888	hsa-miR-654-5p	CLIP-seq
MIRT1323889	hsa-miR-762	CLIP-seq
MIRT1323852	hsa-miR-1252	CLIP-seq
MIRT1323853	hsa-miR-1266	CLIP-seq
MIRT1323854	hsa-miR-1270	CLIP-seq
MIRT1323855	hsa-miR-1272	CLIP-seq
MIRT1323856	hsa-miR-1293	CLIP-seq
MIRT1323857	hsa-miR-143	CLIP-seq
MIRT1323858	hsa-miR-1587	CLIP-seq
MIRT1323859	hsa-miR-2861	CLIP-seq
MIRT1323860	hsa-miR-3151	CLIP-seq
MIRT1323861	hsa-miR-3202	CLIP-seq
MIRT1323862	hsa-miR-3652	CLIP-seq
MIRT1323865	hsa-miR-4417	CLIP-seq
MIRT1323866	hsa-miR-4430	CLIP-seq
MIRT1323867	hsa-miR-4483	CLIP-seq
MIRT1323868	hsa-miR-4492	CLIP-seq
MIRT1323870	hsa-miR-4498	CLIP-seq
MIRT1323871	hsa-miR-4518	CLIP-seq
MIRT1323872	hsa-miR-4533	CLIP-seq
MIRT1323874	hsa-miR-4656	CLIP-seq
MIRT1323875	hsa-miR-4675	CLIP-seq
MIRT1323876	hsa-miR-4683	CLIP-seq
MIRT1323878	hsa-miR-4741	CLIP-seq
MIRT1323880	hsa-miR-4770	CLIP-seq
MIRT1323881	hsa-miR-541	CLIP-seq
MIRT1323886	hsa-miR-620	CLIP-seq
MIRT1323888	hsa-miR-654-5p	CLIP-seq
MIRT1323889	hsa-miR-762	CLIP-seq
MIRT1323852	hsa-miR-1252	CLIP-seq
MIRT1323853	hsa-miR-1266	CLIP-seq
MIRT1323854	hsa-miR-1270	CLIP-seq
MIRT1323855	hsa-miR-1272	CLIP-seq
MIRT1323856	hsa-miR-1293	CLIP-seq
MIRT1323857	hsa-miR-143	CLIP-seq
MIRT1323858	hsa-miR-1587	CLIP-seq
MIRT1323859	hsa-miR-2861	CLIP-seq
MIRT1323860	hsa-miR-3151	CLIP-seq
MIRT1323861	hsa-miR-3202	CLIP-seq
MIRT1323862	hsa-miR-3652	CLIP-seq
MIRT1323863	hsa-miR-3918	CLIP-seq
MIRT1323864	hsa-miR-3936	CLIP-seq
MIRT1323865	hsa-miR-4417	CLIP-seq
MIRT1323866	hsa-miR-4430	CLIP-seq
MIRT1323867	hsa-miR-4483	CLIP-seq
MIRT1323868	hsa-miR-4492	CLIP-seq
MIRT1323869	hsa-miR-4493	CLIP-seq
MIRT1323870	hsa-miR-4498	CLIP-seq
MIRT1323871	hsa-miR-4518	CLIP-seq
MIRT1323872	hsa-miR-4533	CLIP-seq
MIRT1323873	hsa-miR-4651	CLIP-seq
MIRT1323874	hsa-miR-4656	CLIP-seq
MIRT1323875	hsa-miR-4675	CLIP-seq
MIRT1323876	hsa-miR-4683	CLIP-seq
MIRT1323877	hsa-miR-4685-5p	CLIP-seq
MIRT1323878	hsa-miR-4741	CLIP-seq
MIRT1323879	hsa-miR-4753-5p	CLIP-seq
MIRT1323880	hsa-miR-4770	CLIP-seq
MIRT1323881	hsa-miR-541	CLIP-seq
MIRT1323884	hsa-miR-608	CLIP-seq
MIRT1323885	hsa-miR-615-5p	CLIP-seq
MIRT1323886	hsa-miR-620	CLIP-seq
MIRT1323887	hsa-miR-629	CLIP-seq
MIRT1323888	hsa-miR-654-5p	CLIP-seq
MIRT1323889	hsa-miR-762	CLIP-seq
MIRT1323852	hsa-miR-1252	CLIP-seq
MIRT1323853	hsa-miR-1266	CLIP-seq
MIRT1323854	hsa-miR-1270	CLIP-seq
MIRT1323855	hsa-miR-1272	CLIP-seq
MIRT1323856	hsa-miR-1293	CLIP-seq
MIRT1323857	hsa-miR-143	CLIP-seq
MIRT1323858	hsa-miR-1587	CLIP-seq
MIRT1323859	hsa-miR-2861	CLIP-seq
MIRT1323860	hsa-miR-3151	CLIP-seq
MIRT1323861	hsa-miR-3202	CLIP-seq
MIRT1323862	hsa-miR-3652	CLIP-seq
MIRT1323863	hsa-miR-3918	CLIP-seq
MIRT1323864	hsa-miR-3936	CLIP-seq
MIRT1323865	hsa-miR-4417	CLIP-seq
MIRT1323866	hsa-miR-4430	CLIP-seq
MIRT1323867	hsa-miR-4483	CLIP-seq
MIRT1323868	hsa-miR-4492	CLIP-seq
MIRT1323869	hsa-miR-4493	CLIP-seq
MIRT1323870	hsa-miR-4498	CLIP-seq
MIRT1323871	hsa-miR-4518	CLIP-seq
MIRT1323872	hsa-miR-4533	CLIP-seq
MIRT1323873	hsa-miR-4651	CLIP-seq
MIRT1323874	hsa-miR-4656	CLIP-seq
MIRT1323875	hsa-miR-4675	CLIP-seq
MIRT1323876	hsa-miR-4683	CLIP-seq
MIRT1323877	hsa-miR-4685-5p	CLIP-seq
MIRT1323878	hsa-miR-4741	CLIP-seq
MIRT1323879	hsa-miR-4753-5p	CLIP-seq
MIRT1323880	hsa-miR-4770	CLIP-seq
MIRT1323881	hsa-miR-541	CLIP-seq
MIRT1323884	hsa-miR-608	CLIP-seq
MIRT1323885	hsa-miR-615-5p	CLIP-seq
MIRT1323886	hsa-miR-620	CLIP-seq
MIRT1323887	hsa-miR-629	CLIP-seq
MIRT1323888	hsa-miR-654-5p	CLIP-seq
MIRT1323889	hsa-miR-762	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
STAT3	Activation	24376686

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	IDA	10913138
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	10913138, 31837246, 32296183, 36555597
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470, 23580065
GO:0005634	Component	Nucleus	IDA	10913138
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	10851017
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	10913138
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	10851017, 16130169
GO:0005912	Component	Adherens junction	HDA	25468996
GO:0007165	Process	Signal transduction	TAS	16130169
GO:0008156	Process	Negative regulation of DNA replication	TAS	10851017
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	10851017
GO:0014911	Process	Positive regulation of smooth muscle cell migration	IMP	21139050
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	10913138
GO:0044548	Function	S100 protein binding	IBA
GO:0044548	Function	S100 protein binding	IPI	10913138
GO:0046872	Function	Metal ion binding	IEA
GO:0048306	Function	Calcium-dependent protein binding	IBA
GO:0048306	Function	Calcium-dependent protein binding	IDA	10913138
GO:0048306	Function	Calcium-dependent protein binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708, 23533145
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098641	Function	Cadherin binding involved in cell-cell adhesion	HDA	25468996

Other IDs

• MIM: 603114
• HGNC: 10488
• e!Ensembl: ENSG00000163191

Protein

• UniProt ID: P31949
• Protein name: Protein S100-A11 (Calgizzarin) (Metastatic lymph node gene 70 protein) (MLN 70) (Protein S100-C) (S100 calcium-binding protein A11) [Cleaved into: Protein S100-A11, N-terminally processed]
• Protein function: Facilitates the differentiation and the cornification of keratinocytes.
• PDB: 1V4Z, 1V50, 2LUC
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01023	S_100	10 → 52	S-100/ICaBP type calcium binding domain	Domain
  PF00036	EF-hand_1	59 → 87	EF hand	Domain

• Sequence:

  MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVL
  DRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT

• Sequence length: 105

Pathways

Reactome:

Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	15665292, 15668896, 21861103, 26544866		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26544866		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16327996		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	30684913		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31046874		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28446208, 33727634, 36614150	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	33727634	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	15668896		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	25487697		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	25487697	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	15701847		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10752678, 25454514, 30662594		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21153724	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28051137, 38129538	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24376686, 33546025, 37166978	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26508026		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21861103		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	33763485	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31046874	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35752610	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21897749	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26574635		★☆☆☆☆ Found in Text Mining only
CATARACT, MARNER TYPE	Cataract	BEFREE	30684913		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29844306		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31695426		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	31695426		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31695426		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	29569474	Stimulate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	22869607		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16327996, 7889529		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18340452		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33294444, 34080639, 37879212	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	27590262, 30710290		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28513300, 31442606		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	18523305, 24905701, 28446208		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	18523305		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	18385759	Inhibit	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	18385759		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	19577285		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	30684913		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	19577285		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35682908	Associate	★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	15322223		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10486266, 31430050		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32510239, 39684695	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10486266, 31430050		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31430050		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37864150	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	37059863	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	30684913		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	36643579	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	25712376, 29569474, 30182496		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29844306		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	24046531	Stimulate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	24046531		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22287738		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	19048101		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24376686, 29568350		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17537172		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10752678, 25454514, 30662594		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21861103		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26574635		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29375710, 29922945, 30850029		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15668896		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15138568, 25266115, 30662594		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15668896, 28513300, 29922945, 30684913, 30773657, 31046874, 31459098		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31695426		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30216200, 37356089	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25007175	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	30684913		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	30684913		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	34653793	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15668896, 31430050		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21861103, 25940438		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	24905701, 28446208	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29568877		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	38341855	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26574635		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33217795	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29375710, 29922945		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31046874		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31046874, 33580614, 35752610	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23928665, 25880590, 30662594		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	29362358		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	30684913		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15668896		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	19223989		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	28513300		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28513300		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28446208		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	22287738		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	25487697		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	25487697	Associate	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	17537172	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21861103		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15185146		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24046531	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	31312359		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15138568, 25266115, 30662594		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15138568		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	25880590	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26508026	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	9920419	Associate	★☆☆☆☆ Found in Text Mining only
Venous Malformations Multiple Cutaneous and Mucosal	Venous malformation	Pubtator	37927791	Associate	★☆☆☆☆ Found in Text Mining only