S100A10 (S100 calcium binding protein A10)

Gene

• Entrez ID: 6281
• Gene name: S100 calcium binding protein A10
• Gene symbol: S100A10
• Synonyms (NCBI Gene): 42C, ANX2L, ANX2LG, CAL1L, CLP11, Ca[1], GP11, P11, p10
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT048454	hsa-miR-100-5p	CLASH	23622248
MIRT1323804	hsa-miR-105	CLIP-seq
MIRT1323805	hsa-miR-1237	CLIP-seq
MIRT1323806	hsa-miR-1248	CLIP-seq
MIRT1323807	hsa-miR-1275	CLIP-seq
MIRT1323808	hsa-miR-1302	CLIP-seq
MIRT1323809	hsa-miR-1321	CLIP-seq
MIRT1323810	hsa-miR-21	CLIP-seq
MIRT1323811	hsa-miR-3122	CLIP-seq
MIRT1323812	hsa-miR-3126-3p	CLIP-seq
MIRT1323813	hsa-miR-3133	CLIP-seq
MIRT1323814	hsa-miR-3151	CLIP-seq
MIRT1323815	hsa-miR-361-5p	CLIP-seq
MIRT1323816	hsa-miR-3616-3p	CLIP-seq
MIRT1323817	hsa-miR-3675-5p	CLIP-seq
MIRT1323818	hsa-miR-3913-5p	CLIP-seq
MIRT1323819	hsa-miR-4270	CLIP-seq
MIRT1323820	hsa-miR-4271	CLIP-seq
MIRT1323821	hsa-miR-4298	CLIP-seq
MIRT1323822	hsa-miR-4441	CLIP-seq
MIRT1323823	hsa-miR-4447	CLIP-seq
MIRT1323824	hsa-miR-4461	CLIP-seq
MIRT1323825	hsa-miR-4472	CLIP-seq
MIRT1323826	hsa-miR-4490	CLIP-seq
MIRT1323827	hsa-miR-4511	CLIP-seq
MIRT1323828	hsa-miR-4525	CLIP-seq
MIRT1323829	hsa-miR-4639-5p	CLIP-seq
MIRT1323830	hsa-miR-4665-5p	CLIP-seq
MIRT1323831	hsa-miR-4670-5p	CLIP-seq
MIRT1323832	hsa-miR-4686	CLIP-seq
MIRT1323833	hsa-miR-4693-3p	CLIP-seq
MIRT1323834	hsa-miR-4712-3p	CLIP-seq
MIRT1323835	hsa-miR-4721	CLIP-seq
MIRT1323836	hsa-miR-4723-5p	CLIP-seq
MIRT1323837	hsa-miR-4725-3p	CLIP-seq
MIRT1323838	hsa-miR-4739	CLIP-seq
MIRT1323839	hsa-miR-4756-5p	CLIP-seq
MIRT1323840	hsa-miR-4760-5p	CLIP-seq
MIRT1323841	hsa-miR-4768-5p	CLIP-seq
MIRT1323842	hsa-miR-4774-5p	CLIP-seq
MIRT1323843	hsa-miR-486-3p	CLIP-seq
MIRT1323844	hsa-miR-491-5p	CLIP-seq
MIRT1323845	hsa-miR-500a	CLIP-seq
MIRT1323846	hsa-miR-548c-3p	CLIP-seq
MIRT1323847	hsa-miR-549	CLIP-seq
MIRT1323848	hsa-miR-590-5p	CLIP-seq
MIRT1323849	hsa-miR-595	CLIP-seq
MIRT1323850	hsa-miR-625	CLIP-seq
MIRT1323851	hsa-miR-767-3p	CLIP-seq
MIRT1323804	hsa-miR-105	CLIP-seq
MIRT1323841	hsa-miR-4768-5p	CLIP-seq
MIRT1323804	hsa-miR-105	CLIP-seq
MIRT1323805	hsa-miR-1237	CLIP-seq
MIRT1323806	hsa-miR-1248	CLIP-seq
MIRT1323807	hsa-miR-1275	CLIP-seq
MIRT1323808	hsa-miR-1302	CLIP-seq
MIRT1323811	hsa-miR-3122	CLIP-seq
MIRT1323814	hsa-miR-3151	CLIP-seq
MIRT1323815	hsa-miR-361-5p	CLIP-seq
MIRT1323816	hsa-miR-3616-3p	CLIP-seq
MIRT1323817	hsa-miR-3675-5p	CLIP-seq
MIRT1323818	hsa-miR-3913-5p	CLIP-seq
MIRT1323819	hsa-miR-4270	CLIP-seq
MIRT1323820	hsa-miR-4271	CLIP-seq
MIRT1323821	hsa-miR-4298	CLIP-seq
MIRT1323822	hsa-miR-4441	CLIP-seq
MIRT1323823	hsa-miR-4447	CLIP-seq
MIRT1323824	hsa-miR-4461	CLIP-seq
MIRT1323825	hsa-miR-4472	CLIP-seq
MIRT1323828	hsa-miR-4525	CLIP-seq
MIRT1323829	hsa-miR-4639-5p	CLIP-seq
MIRT1323830	hsa-miR-4665-5p	CLIP-seq
MIRT1323831	hsa-miR-4670-5p	CLIP-seq
MIRT1323832	hsa-miR-4686	CLIP-seq
MIRT1323833	hsa-miR-4693-3p	CLIP-seq
MIRT1323834	hsa-miR-4712-3p	CLIP-seq
MIRT1323835	hsa-miR-4721	CLIP-seq
MIRT1323836	hsa-miR-4723-5p	CLIP-seq
MIRT1323837	hsa-miR-4725-3p	CLIP-seq
MIRT1323840	hsa-miR-4760-5p	CLIP-seq
MIRT1323841	hsa-miR-4768-5p	CLIP-seq
MIRT1323843	hsa-miR-486-3p	CLIP-seq
MIRT1323844	hsa-miR-491-5p	CLIP-seq
MIRT1323845	hsa-miR-500a	CLIP-seq
MIRT1323846	hsa-miR-548c-3p	CLIP-seq
MIRT1323847	hsa-miR-549	CLIP-seq
MIRT1323849	hsa-miR-595	CLIP-seq
MIRT1323850	hsa-miR-625	CLIP-seq
MIRT1323851	hsa-miR-767-3p	CLIP-seq
MIRT1323808	hsa-miR-1302	CLIP-seq
MIRT1323811	hsa-miR-3122	CLIP-seq
MIRT1323815	hsa-miR-361-5p	CLIP-seq
MIRT1323818	hsa-miR-3913-5p	CLIP-seq
MIRT1323821	hsa-miR-4298	CLIP-seq
MIRT1323831	hsa-miR-4670-5p	CLIP-seq
MIRT1323847	hsa-miR-549	CLIP-seq
MIRT1323805	hsa-miR-1237	CLIP-seq
MIRT1323806	hsa-miR-1248	CLIP-seq
MIRT1323817	hsa-miR-3675-5p	CLIP-seq
MIRT1323845	hsa-miR-500a	CLIP-seq
MIRT1323851	hsa-miR-767-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
STAT1	Activation	12645529

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001765	Process	Membrane raft assembly	IDA	23861394
GO:0005509	Function	Calcium ion binding	IBA
GO:0005515	Function	Protein binding	IPI	14699089, 23091277, 23415230, 23861394, 24457100, 26941067, 30021884, 31837246, 32296183, 33961781
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005737	Component	Cytoplasm	IBA
GO:0005886	Component	Plasma membrane	IDA	3126079
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	3126079
GO:0006900	Process	Vesicle budding from membrane	IDA	23861394
GO:0008289	Function	Lipid binding	IDA	23861394
GO:0009986	Component	Cell surface	IEA
GO:0010756	Process	Positive regulation of plasminogen activation	IDA	9836589
GO:0016363	Component	Nuclear matrix	NAS	23415230
GO:0031012	Component	Extracellular matrix	HDA	28675934
GO:0042789	Process	MRNA transcription by RNA polymerase II	IEA
GO:0042789	Process	MRNA transcription by RNA polymerase II	ISO
GO:0042803	Function	Protein homodimerization activity	IDA	23091277
GO:0043547	Process	Positive regulation of GTPase activity	IMP	23129259
GO:0044325	Function	Transmembrane transporter binding	IBA
GO:0044325	Function	Transmembrane transporter binding	IPI	12198146
GO:0045121	Component	Membrane raft	IDA	14699089
GO:0045921	Process	Positive regulation of exocytosis	NAS	22940583
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISO
GO:0048306	Function	Calcium-dependent protein binding	IBA
GO:0050767	Process	Regulation of neurogenesis	IEA
GO:0050767	Process	Regulation of neurogenesis	ISO
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	23129259
GO:0051894	Process	Positive regulation of focal adhesion assembly	IMP	23129259
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0072659	Process	Protein localization to plasma membrane	IDA	12198146
GO:0090575	Component	RNA polymerase II transcription regulator complex	EXP	23415230
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:0098797	Component	Plasma membrane protein complex	IEA
GO:0098797	Component	Plasma membrane protein complex	IPI	9886297, 23275167
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IMP	23129259
GO:1905686	Process	Positive regulation of plasma membrane repair	NAS	22940583
GO:1990665	Component	AnxA2-p11 complex	IDA	23091277, 23861394

Other IDs

• MIM: 114085
• HGNC: 10487
• e!Ensembl: ENSG00000197747

Protein

• UniProt ID: P60903
• Protein name: Protein S100-A10 (Calpactin I light chain) (Calpactin-1 light chain) (Cellular ligand of annexin II) (S100 calcium-binding protein A10) (p10 protein) (p11)
• Protein function: Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase.
• PDB: 1A4P, 1BT6, 4DRW, 4FTG, 4HRE, 4HRG, 4HRH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01023	S_100	5 → 44	S-100/ICaBP type calcium binding domain	Domain

• Sequence:

  MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD
  QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

• Sequence length: 97

Pathways

KEGG:

Salmonella infection

Reactome:

Dissolution of Fibrin Clot

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSED MOOD	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE EPISODE, UNSPECIFIED	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSION, SINGLE EPISODE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEDULLOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	26465153		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	17330099		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	17330099		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	28687976, 30206209		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	30268496		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	18289715		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26465153		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	17579622		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	CTD_human_DG	17579622		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	35016256	Stimulate	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	31059997		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	19815710, 31337969		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	19815710, 31337969		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28796539		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	19380152, 21722919		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	19380152, 21722919		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	16273201, 20383413, 31728728		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21153724	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23828264	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	17695432	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	26232338		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23598417, 32191631, 33546025, 36456877	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36631249	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	30009399	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17083565	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21897749	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26925708, 30572596, 31092442, 31739800		★☆☆☆☆ Found in Text Mining only
CATARACT, MARNER TYPE	Cataract	BEFREE	30319361		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31059997		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	26465153		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	17579622		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	CTD_human_DG	17579622		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	30320415, 30499177		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30499177		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27955827		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23828264, 29956073		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	14570893, 23828264, 33160379, 33294444	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11734338, 31585940		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	24905701, 31545916		★☆☆☆☆ Found in Text Mining only
Depression, Neurotic	Mental Depression	CTD_human_DG	21682946		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	16400147, 17510952, 18440154, 18838110, 19380152, 19702551, 20962329, 21367534, 22990943, 26821757, 27457815, 28137881, 28507317, 29550211, 30617637, 31337969		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	17241856, 34356598	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	21367534, 21722919		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	CTD_human_DG	21682946		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	28137881	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	24620999	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Syndrome	Mental Depression	CTD_human_DG	21682946		★☆☆☆☆ Found in Text Mining only
Desmoplastic Medulloblastoma	Medulloblastoma	CTD_human_DG	17579622		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24670789		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	28458330	Associate	★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	CTD_human_DG	21682946		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33931666	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	22589250		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31092442		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	40118787	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28179399		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31585800		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	25880590		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Tendon Sheath	Giant cell tumor of tendon sheath	Pubtator	24604026	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11563632, 27436023, 27678152		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11563632, 27436023, 27678152		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35779750	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	12970356		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	3971322		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	21310922	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary liability to pressure palsies	Hereditary Liability To Pressure Palsies	BEFREE	8565626		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	31771992		★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	34690553	Associate	★☆☆☆☆ Found in Text Mining only
Hypersomnia	Hypersomnia	BEFREE	29684437		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	40118787	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Ichthyosis Bullosa Of Siemens	BEFREE	23595519		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	17241856		★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	BEFREE	25283602		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	17241856, 23595519		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	17241856	Stimulate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	28458330	Associate	★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	16351635		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31063508		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30320415, 30499177		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	31612598		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	29725008	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	21310922	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	17330099		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29725008		★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	30538751		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21372205	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	31536674	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28987592, 31059997		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33931666	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	12716467	Inhibit	★☆☆☆☆ Found in Text Mining only
Major depression, single episode	Mental Depression	BEFREE	24620999		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major depression, single episode	Mental Depression	PSYGENET_DG	24620999		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	17510952, 18838110, 19380152, 20863517, 27616678, 28137881, 29334322, 29353887, 30760886		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	20863517, 20962330		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malabsorption Syndrome	Malabsorption Syndrome	BEFREE	29321312		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16273201, 20383413		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26925708, 30572596, 31739800		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30009399		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30394687, 31258789		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25602368, 26232338, 27351226, 29956073, 30572596, 30675195, 31612598, 31739800		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	28088747		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	17579622		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	CTD_human_DG	17579622		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	Pubtator	17579622, 18664619	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medullomyoblastoma	Medullomyoblastoma	CTD_human_DG	17579622		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	CTD_human_DG	21682946		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19521263		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30216200	Associate	★☆☆☆☆ Found in Text Mining only
Melanotic medulloblastoma	Medulloblastoma	CTD_human_DG	17579622		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	11859969		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	16400147, 17510952, 18440154, 18838110, 19380152, 19702551, 20962329, 21367534, 22990943, 26821757, 27457815, 28137881, 28507317, 29550211, 30617637, 31337969		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	24620999		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	19380152, 20863517		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	31059997		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	PSYGENET_DG	20962330		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Motor neuron atrophy	Motor neuron atrophy	BEFREE	31439839		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11859969, 22964225, 24604026, 24727000, 25602368, 25880590, 28537099, 30268496, 31028568, 31728728, 31739800		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25841787		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	21093564		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	31728728		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	24905701	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	35579448	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26925708, 30572596, 31739800		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30558666, 30621740, 33217795	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30009399		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30009399		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	30009399		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30009399, 33580614	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28137881		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	28137881	Inhibit	★☆☆☆☆ Found in Text Mining only
Paroxysmal nonkinesigenic dyskinesia	Paroxysmal nonkinesigenic dyskinesia	Pubtator	33160379	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	2345427	Associate	★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	31059997		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	18440154, 19380152, 20863517		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	27436023		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11734338, 31585940		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	29321312		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29746127		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	17317953		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19380152		★☆☆☆☆ Found in Text Mining only
Smith-Magenis syndrome	Smith-Magenis Syndrome	BEFREE	8565626		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	29440993		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15185146		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18254958	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	30268496		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28179399		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30394687, 31258789		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18793447	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	31028568		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	17695432	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	17510952, 18838110, 19380152, 28137881, 30760886		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	20863517, 20962330		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	CTD_human_DG	21682946		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Varicosity	Vulval varices	BEFREE	28638718		★☆☆☆☆ Found in Text Mining only