S100A5 (S100 calcium binding protein A5)

Gene

• Entrez ID: 6276
• Gene name: S100 calcium binding protein A5
• Gene symbol: S100A5
• Synonyms (NCBI Gene): S100D
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017899	hsa-miR-335-5p	Microarray	18185580
MIRT1324072	hsa-miR-3616-3p	CLIP-seq
MIRT1324073	hsa-miR-4436b-3p	CLIP-seq
MIRT1324074	hsa-miR-4710	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005507	Function	Copper ion binding	IDA	19536568
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IDA	19536568
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	31837246
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12118070
GO:0008270	Function	Zinc ion binding	IDA	19536568
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	19536568
GO:0043025	Component	Neuronal cell body	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046914	Function	Transition metal ion binding	IEA
GO:0048306	Function	Calcium-dependent protein binding	IBA

Other IDs

• MIM: 176991
• HGNC: 10495
• e!Ensembl: ENSG00000196420

Protein

• UniProt ID: P33763
• Protein name: Protein S100-A5 (Protein S-100D) (S100 calcium-binding protein A5)
• Protein function: Binds calcium, zinc and copper. One subunit can simultaneously bind 2 calcium ions or 2 copper ions plus 1 zinc ion. Calcium and copper ions compete for the same binding sites.
• PDB: 2KAX, 2KAY, 4DIR, 6WN7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01023	S_100	5 → 43	S-100/ICaBP type calcium binding domain	Domain

• Sequence:

  METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLD
  KNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK

• Sequence length: 92

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	BEFREE	31344532		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	9989446	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11855835		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33546025	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31344532		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11855835		★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	25257527		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	36705323	Associate	★☆☆☆☆ Found in Text Mining only
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	25257527		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30558666	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33217795	Stimulate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11855835		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	37414584	Associate	★☆☆☆☆ Found in Text Mining only