Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6272
Gene name	Sortilin 1
Gene symbol	SORT1
Synonyms (NCBI Gene)	Gp95LDLCQ6NT3NTR3
Chromosome	1
Chromosome location	1p13.3\|1p21.3-p13.1
Summary	This gene encodes a member of the VPS10-related sortilin family of proteins. The encoded preproprotein is proteolytically processed by furin to generate the mature receptor. This receptor plays a role in the trafficking of different proteins to either the

461

Show/Hide all (461)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025550	hsa-miR-34a-5p	Proteomics	21566225
MIRT046808	hsa-miR-222-3p	CLASH	23622248
MIRT045915	hsa-miR-125b-5p	CLASH	23622248
MIRT439561	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439560	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT439558	hsa-miR-1185-5p	HITS-CLIP	24374217
MIRT726474	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT726473	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT726471	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT726472	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT439561	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439560	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT439558	hsa-miR-1185-5p	HITS-CLIP	24374217
MIRT734840	hsa-miR-378a-3p	Luciferase reporter assayChIP-seq	32226531
MIRT1379731	hsa-miR-1233	CLIP-seq
MIRT1379732	hsa-miR-1236	CLIP-seq
MIRT1379733	hsa-miR-1255a	CLIP-seq
MIRT1379734	hsa-miR-1255b	CLIP-seq
MIRT1379735	hsa-miR-1264	CLIP-seq
MIRT1379736	hsa-miR-1290	CLIP-seq
MIRT1379737	hsa-miR-130a	CLIP-seq
MIRT1379738	hsa-miR-130b	CLIP-seq
MIRT1379739	hsa-miR-146a	CLIP-seq
MIRT1379740	hsa-miR-146b-3p	CLIP-seq
MIRT1379741	hsa-miR-146b-5p	CLIP-seq
MIRT1379742	hsa-miR-186	CLIP-seq
MIRT1379743	hsa-miR-193a-3p	CLIP-seq
MIRT1379744	hsa-miR-193b	CLIP-seq
MIRT1379745	hsa-miR-216b	CLIP-seq
MIRT1379746	hsa-miR-221	CLIP-seq
MIRT1379747	hsa-miR-222	CLIP-seq
MIRT1379748	hsa-miR-2355-3p	CLIP-seq
MIRT1379749	hsa-miR-301a	CLIP-seq
MIRT1379750	hsa-miR-301b	CLIP-seq
MIRT1379751	hsa-miR-3162-3p	CLIP-seq
MIRT1379752	hsa-miR-3167	CLIP-seq
MIRT1379753	hsa-miR-3173-5p	CLIP-seq
MIRT1379754	hsa-miR-3174	CLIP-seq
MIRT1379755	hsa-miR-3182	CLIP-seq
MIRT1379756	hsa-miR-3184	CLIP-seq
MIRT1379757	hsa-miR-323-3p	CLIP-seq
MIRT1379758	hsa-miR-325	CLIP-seq
MIRT1379759	hsa-miR-3605-5p	CLIP-seq
MIRT1379760	hsa-miR-3616-3p	CLIP-seq
MIRT1379761	hsa-miR-3666	CLIP-seq
MIRT1379762	hsa-miR-374a	CLIP-seq
MIRT1379763	hsa-miR-374b	CLIP-seq
MIRT1379764	hsa-miR-3923	CLIP-seq
MIRT1379765	hsa-miR-423-5p	CLIP-seq
MIRT1379766	hsa-miR-4253	CLIP-seq
MIRT1379767	hsa-miR-4272	CLIP-seq
MIRT1379768	hsa-miR-4292	CLIP-seq
MIRT1379769	hsa-miR-4295	CLIP-seq
MIRT1379770	hsa-miR-4474-3p	CLIP-seq
MIRT1379771	hsa-miR-4477b	CLIP-seq
MIRT1379772	hsa-miR-454	CLIP-seq
MIRT1379773	hsa-miR-4646-3p	CLIP-seq
MIRT1379774	hsa-miR-4667-5p	CLIP-seq
MIRT1379775	hsa-miR-4671-3p	CLIP-seq
MIRT1379776	hsa-miR-4688	CLIP-seq
MIRT1379777	hsa-miR-4695-3p	CLIP-seq
MIRT1379778	hsa-miR-4698	CLIP-seq
MIRT1379779	hsa-miR-4700-5p	CLIP-seq
MIRT1379780	hsa-miR-4714-3p	CLIP-seq
MIRT1379781	hsa-miR-4715-5p	CLIP-seq
MIRT1379782	hsa-miR-4721	CLIP-seq
MIRT1379783	hsa-miR-4728-5p	CLIP-seq
MIRT1379784	hsa-miR-4761-3p	CLIP-seq
MIRT1379785	hsa-miR-4775	CLIP-seq
MIRT1379786	hsa-miR-4795-3p	CLIP-seq
MIRT1379787	hsa-miR-486-3p	CLIP-seq
MIRT1379788	hsa-miR-487b	CLIP-seq
MIRT1379789	hsa-miR-498	CLIP-seq
MIRT1379790	hsa-miR-499-3p	CLIP-seq
MIRT1379791	hsa-miR-499a-3p	CLIP-seq
MIRT1379792	hsa-miR-508-5p	CLIP-seq
MIRT1379793	hsa-miR-522	CLIP-seq
MIRT1379794	hsa-miR-544	CLIP-seq
MIRT1379795	hsa-miR-548aa	CLIP-seq
MIRT1379796	hsa-miR-548p	CLIP-seq
MIRT1379797	hsa-miR-548u	CLIP-seq
MIRT1379798	hsa-miR-548v	CLIP-seq
MIRT1379799	hsa-miR-571	CLIP-seq
MIRT1379800	hsa-miR-584	CLIP-seq
MIRT1379801	hsa-miR-589	CLIP-seq
MIRT1379802	hsa-miR-590-3p	CLIP-seq
MIRT1379803	hsa-miR-619	CLIP-seq
MIRT1379804	hsa-miR-637	CLIP-seq
MIRT1379805	hsa-miR-658	CLIP-seq
MIRT1379806	hsa-miR-766	CLIP-seq
MIRT1379807	hsa-miR-874	CLIP-seq
MIRT1379808	hsa-miR-876-5p	CLIP-seq
MIRT1379809	hsa-miR-892b	CLIP-seq
MIRT1379810	hsa-miR-934	CLIP-seq
MIRT1379811	hsa-miR-105	CLIP-seq
MIRT1379812	hsa-miR-1294	CLIP-seq
MIRT1379813	hsa-miR-138	CLIP-seq
MIRT1379740	hsa-miR-146b-3p	CLIP-seq
MIRT1379742	hsa-miR-186	CLIP-seq
MIRT1379814	hsa-miR-2116	CLIP-seq
MIRT1379815	hsa-miR-28-5p	CLIP-seq
MIRT1379816	hsa-miR-298	CLIP-seq
MIRT1379817	hsa-miR-3128	CLIP-seq
MIRT1379818	hsa-miR-3133	CLIP-seq
MIRT1379819	hsa-miR-3139	CLIP-seq
MIRT1379820	hsa-miR-3150b-3p	CLIP-seq
MIRT1379821	hsa-miR-3161	CLIP-seq
MIRT1379822	hsa-miR-3170	CLIP-seq
MIRT1379753	hsa-miR-3173-5p	CLIP-seq
MIRT1379756	hsa-miR-3184	CLIP-seq
MIRT1379823	hsa-miR-3198	CLIP-seq
MIRT1379824	hsa-miR-339-5p	CLIP-seq
MIRT1379825	hsa-miR-345	CLIP-seq
MIRT1379826	hsa-miR-3606	CLIP-seq
MIRT1379827	hsa-miR-3650	CLIP-seq
MIRT1379828	hsa-miR-3689d	CLIP-seq
MIRT1379829	hsa-miR-370	CLIP-seq
MIRT1379830	hsa-miR-3944-5p	CLIP-seq
MIRT1379765	hsa-miR-423-5p	CLIP-seq
MIRT1379831	hsa-miR-4252	CLIP-seq
MIRT1379832	hsa-miR-4255	CLIP-seq
MIRT1379833	hsa-miR-4257	CLIP-seq
MIRT1379834	hsa-miR-4290	CLIP-seq
MIRT1379768	hsa-miR-4292	CLIP-seq
MIRT1379835	hsa-miR-4309	CLIP-seq
MIRT1379836	hsa-miR-4316	CLIP-seq
MIRT1379837	hsa-miR-432	CLIP-seq
MIRT1379838	hsa-miR-4446-3p	CLIP-seq
MIRT1379839	hsa-miR-4487	CLIP-seq
MIRT1379840	hsa-miR-450b-3p	CLIP-seq
MIRT1379841	hsa-miR-4654	CLIP-seq
MIRT1379842	hsa-miR-4656	CLIP-seq
MIRT1379843	hsa-miR-4662a-5p	CLIP-seq
MIRT1379844	hsa-miR-4677-5p	CLIP-seq
MIRT1379776	hsa-miR-4688	CLIP-seq
MIRT1379845	hsa-miR-4689	CLIP-seq
MIRT1379846	hsa-miR-4713-3p	CLIP-seq
MIRT1379847	hsa-miR-4720-5p	CLIP-seq
MIRT1379782	hsa-miR-4721	CLIP-seq
MIRT1379783	hsa-miR-4728-5p	CLIP-seq
MIRT1379848	hsa-miR-4747-5p	CLIP-seq
MIRT1379849	hsa-miR-4769-5p	CLIP-seq
MIRT1379850	hsa-miR-4784	CLIP-seq
MIRT1379851	hsa-miR-4795-5p	CLIP-seq
MIRT1379852	hsa-miR-4799-3p	CLIP-seq
MIRT1379787	hsa-miR-486-3p	CLIP-seq
MIRT1379794	hsa-miR-544	CLIP-seq
MIRT1379853	hsa-miR-580	CLIP-seq
MIRT1379854	hsa-miR-628-5p	CLIP-seq
MIRT1379855	hsa-miR-638	CLIP-seq
MIRT1379856	hsa-miR-668	CLIP-seq
MIRT1379857	hsa-miR-708	CLIP-seq
MIRT1379858	hsa-miR-769-3p	CLIP-seq
MIRT1379807	hsa-miR-874	CLIP-seq
MIRT1379859	hsa-miR-921	CLIP-seq
MIRT1553941	hsa-miR-4652-3p	CLIP-seq
MIRT1379774	hsa-miR-4667-5p	CLIP-seq
MIRT1379779	hsa-miR-4700-5p	CLIP-seq
MIRT1379811	hsa-miR-105	CLIP-seq
MIRT1379732	hsa-miR-1236	CLIP-seq
MIRT2113479	hsa-miR-1305	CLIP-seq
MIRT1379813	hsa-miR-138	CLIP-seq
MIRT2113480	hsa-miR-139-5p	CLIP-seq
MIRT1379739	hsa-miR-146a	CLIP-seq
MIRT1379741	hsa-miR-146b-5p	CLIP-seq
MIRT2113481	hsa-miR-155	CLIP-seq
MIRT2113482	hsa-miR-185	CLIP-seq
MIRT2113483	hsa-miR-2117	CLIP-seq
MIRT2113484	hsa-miR-216a	CLIP-seq
MIRT1379818	hsa-miR-3133	CLIP-seq
MIRT2113485	hsa-miR-3138	CLIP-seq
MIRT2113486	hsa-miR-3144-5p	CLIP-seq
MIRT2113487	hsa-miR-3150a-3p	CLIP-seq
MIRT2113488	hsa-miR-3157-5p	CLIP-seq
MIRT2113489	hsa-miR-3160-3p	CLIP-seq
MIRT2113490	hsa-miR-3175	CLIP-seq
MIRT2113491	hsa-miR-3189-3p	CLIP-seq
MIRT2113492	hsa-miR-330-3p	CLIP-seq
MIRT1379824	hsa-miR-339-5p	CLIP-seq
MIRT1379760	hsa-miR-3616-3p	CLIP-seq
MIRT2113493	hsa-miR-3622a-5p	CLIP-seq
MIRT2113494	hsa-miR-3622b-5p	CLIP-seq
MIRT2113495	hsa-miR-3653	CLIP-seq
MIRT2113496	hsa-miR-3658	CLIP-seq
MIRT2113497	hsa-miR-3675-3p	CLIP-seq
MIRT1379828	hsa-miR-3689d	CLIP-seq
MIRT1379829	hsa-miR-370	CLIP-seq
MIRT2113498	hsa-miR-3714	CLIP-seq
MIRT2113499	hsa-miR-3945	CLIP-seq
MIRT1379766	hsa-miR-4253	CLIP-seq
MIRT2113500	hsa-miR-4268	CLIP-seq
MIRT2113501	hsa-miR-4269	CLIP-seq
MIRT2113502	hsa-miR-4289	CLIP-seq
MIRT2113503	hsa-miR-4306	CLIP-seq
MIRT2113504	hsa-miR-4420	CLIP-seq
MIRT2113505	hsa-miR-4448	CLIP-seq
MIRT2113506	hsa-miR-4468	CLIP-seq
MIRT1379770	hsa-miR-4474-3p	CLIP-seq
MIRT1379839	hsa-miR-4487	CLIP-seq
MIRT2113507	hsa-miR-451b	CLIP-seq
MIRT2113508	hsa-miR-4520a-3p	CLIP-seq
MIRT2113509	hsa-miR-4644	CLIP-seq
MIRT1553941	hsa-miR-4652-3p	CLIP-seq
MIRT1379774	hsa-miR-4667-5p	CLIP-seq
MIRT2113510	hsa-miR-4684-5p	CLIP-seq
MIRT1379777	hsa-miR-4695-3p	CLIP-seq
MIRT1379779	hsa-miR-4700-5p	CLIP-seq
MIRT2113511	hsa-miR-4704-5p	CLIP-seq
MIRT2113512	hsa-miR-4717-3p	CLIP-seq
MIRT1379782	hsa-miR-4721	CLIP-seq
MIRT2113513	hsa-miR-4738-3p	CLIP-seq
MIRT2113514	hsa-miR-4752	CLIP-seq
MIRT2113515	hsa-miR-4753-3p	CLIP-seq
MIRT1379784	hsa-miR-4761-3p	CLIP-seq
MIRT2113516	hsa-miR-4800-5p	CLIP-seq
MIRT1379787	hsa-miR-486-3p	CLIP-seq
MIRT2113517	hsa-miR-548c-3p	CLIP-seq
MIRT2113518	hsa-miR-558	CLIP-seq
MIRT2113519	hsa-miR-564	CLIP-seq
MIRT2113520	hsa-miR-579	CLIP-seq
MIRT2113521	hsa-miR-607	CLIP-seq
MIRT2113522	hsa-miR-616	CLIP-seq
MIRT2113523	hsa-miR-633	CLIP-seq
MIRT2113524	hsa-miR-635	CLIP-seq
MIRT2113525	hsa-miR-659	CLIP-seq
MIRT2113526	hsa-miR-661	CLIP-seq
MIRT2113527	hsa-miR-758	CLIP-seq
MIRT2113528	hsa-miR-892a	CLIP-seq
MIRT2113529	hsa-miR-939	CLIP-seq
MIRT1379811	hsa-miR-105	CLIP-seq
MIRT2336501	hsa-miR-1193	CLIP-seq
MIRT2336502	hsa-miR-1200	CLIP-seq
MIRT2336503	hsa-miR-122	CLIP-seq
MIRT1379732	hsa-miR-1236	CLIP-seq
MIRT2336504	hsa-miR-1273g	CLIP-seq
MIRT2336505	hsa-miR-1321	CLIP-seq
MIRT2336506	hsa-miR-136	CLIP-seq
MIRT1379746	hsa-miR-221	CLIP-seq
MIRT1379747	hsa-miR-222	CLIP-seq
MIRT2336507	hsa-miR-3074-5p	CLIP-seq
MIRT2336508	hsa-miR-3120-3p	CLIP-seq
MIRT2336509	hsa-miR-3140-5p	CLIP-seq
MIRT2113486	hsa-miR-3144-5p	CLIP-seq
MIRT2113489	hsa-miR-3160-3p	CLIP-seq
MIRT1379755	hsa-miR-3182	CLIP-seq
MIRT1379756	hsa-miR-3184	CLIP-seq
MIRT2336510	hsa-miR-3192	CLIP-seq
MIRT2113492	hsa-miR-330-3p	CLIP-seq
MIRT2336511	hsa-miR-361-3p	CLIP-seq
MIRT1379760	hsa-miR-3616-3p	CLIP-seq
MIRT2336512	hsa-miR-3647-3p	CLIP-seq
MIRT2336513	hsa-miR-3692	CLIP-seq
MIRT2336514	hsa-miR-3941	CLIP-seq
MIRT1379765	hsa-miR-423-5p	CLIP-seq
MIRT2336515	hsa-miR-4270	CLIP-seq
MIRT2336516	hsa-miR-4282	CLIP-seq
MIRT2336517	hsa-miR-4286	CLIP-seq
MIRT2113502	hsa-miR-4289	CLIP-seq
MIRT2336518	hsa-miR-4318	CLIP-seq
MIRT2336519	hsa-miR-4419a	CLIP-seq
MIRT2336520	hsa-miR-4441	CLIP-seq
MIRT2336521	hsa-miR-4459	CLIP-seq
MIRT1379839	hsa-miR-4487	CLIP-seq
MIRT2336522	hsa-miR-4510	CLIP-seq
MIRT2336523	hsa-miR-4639-3p	CLIP-seq
MIRT1553941	hsa-miR-4652-3p	CLIP-seq
MIRT2336524	hsa-miR-466	CLIP-seq
MIRT2336525	hsa-miR-4670-3p	CLIP-seq
MIRT2336526	hsa-miR-4672	CLIP-seq
MIRT1379776	hsa-miR-4688	CLIP-seq
MIRT2336527	hsa-miR-4693-5p	CLIP-seq
MIRT1379777	hsa-miR-4695-3p	CLIP-seq
MIRT2336528	hsa-miR-4712-5p	CLIP-seq
MIRT2113512	hsa-miR-4717-3p	CLIP-seq
MIRT1379782	hsa-miR-4721	CLIP-seq
MIRT2336529	hsa-miR-4722-5p	CLIP-seq
MIRT2336530	hsa-miR-4725-5p	CLIP-seq
MIRT1379783	hsa-miR-4728-5p	CLIP-seq
MIRT2336531	hsa-miR-4731-3p	CLIP-seq
MIRT2336532	hsa-miR-4739	CLIP-seq
MIRT2336533	hsa-miR-4756-5p	CLIP-seq
MIRT1379784	hsa-miR-4761-3p	CLIP-seq
MIRT2336534	hsa-miR-4779	CLIP-seq
MIRT2336535	hsa-miR-4801	CLIP-seq
MIRT1379787	hsa-miR-486-3p	CLIP-seq
MIRT1379790	hsa-miR-499-3p	CLIP-seq
MIRT1379791	hsa-miR-499a-3p	CLIP-seq
MIRT2336536	hsa-miR-504	CLIP-seq
MIRT2336537	hsa-miR-520d-5p	CLIP-seq
MIRT2336538	hsa-miR-524-5p	CLIP-seq
MIRT1379796	hsa-miR-548p	CLIP-seq
MIRT1379798	hsa-miR-548v	CLIP-seq
MIRT2113526	hsa-miR-661	CLIP-seq
MIRT2336539	hsa-miR-770-5p	CLIP-seq
MIRT2113528	hsa-miR-892a	CLIP-seq
MIRT2460254	hsa-miR-3613-3p	CLIP-seq
MIRT2460254	hsa-miR-3613-3p	CLIP-seq
MIRT1379811	hsa-miR-105	CLIP-seq
MIRT2336501	hsa-miR-1193	CLIP-seq
MIRT2630319	hsa-miR-1224-3p	CLIP-seq
MIRT1379731	hsa-miR-1233	CLIP-seq
MIRT2630320	hsa-miR-1260	CLIP-seq
MIRT2630321	hsa-miR-1260b	CLIP-seq
MIRT2630322	hsa-miR-1280	CLIP-seq
MIRT1379812	hsa-miR-1294	CLIP-seq
MIRT2630323	hsa-miR-1296	CLIP-seq
MIRT2630324	hsa-miR-1322	CLIP-seq
MIRT2630325	hsa-miR-181a	CLIP-seq
MIRT2630326	hsa-miR-181b	CLIP-seq
MIRT2630327	hsa-miR-181c	CLIP-seq
MIRT2630328	hsa-miR-181d	CLIP-seq
MIRT2630329	hsa-miR-18a	CLIP-seq
MIRT2630330	hsa-miR-18b	CLIP-seq
MIRT2630331	hsa-miR-1976	CLIP-seq
MIRT2630332	hsa-miR-200b	CLIP-seq
MIRT2630333	hsa-miR-200c	CLIP-seq
MIRT2630334	hsa-miR-2909	CLIP-seq
MIRT2113485	hsa-miR-3138	CLIP-seq
MIRT2630335	hsa-miR-3194-3p	CLIP-seq
MIRT1379760	hsa-miR-3616-3p	CLIP-seq
MIRT2113493	hsa-miR-3622a-5p	CLIP-seq
MIRT2336512	hsa-miR-3647-3p	CLIP-seq
MIRT2630336	hsa-miR-3671	CLIP-seq
MIRT2336513	hsa-miR-3692	CLIP-seq
MIRT1379829	hsa-miR-370	CLIP-seq
MIRT1379762	hsa-miR-374a	CLIP-seq
MIRT1379763	hsa-miR-374b	CLIP-seq
MIRT2630337	hsa-miR-374c	CLIP-seq
MIRT2630338	hsa-miR-378g	CLIP-seq
MIRT2630339	hsa-miR-3907	CLIP-seq
MIRT2630340	hsa-miR-3922-5p	CLIP-seq
MIRT2630341	hsa-miR-3940-5p	CLIP-seq
MIRT2336514	hsa-miR-3941	CLIP-seq
MIRT2630342	hsa-miR-3942-3p	CLIP-seq
MIRT2630343	hsa-miR-3977	CLIP-seq
MIRT2630344	hsa-miR-4262	CLIP-seq
MIRT2113500	hsa-miR-4268	CLIP-seq
MIRT2113501	hsa-miR-4269	CLIP-seq
MIRT2336516	hsa-miR-4282	CLIP-seq
MIRT2113502	hsa-miR-4289	CLIP-seq
MIRT2630345	hsa-miR-429	CLIP-seq
MIRT1379836	hsa-miR-4316	CLIP-seq
MIRT2630346	hsa-miR-433	CLIP-seq
MIRT2630347	hsa-miR-4436b-3p	CLIP-seq
MIRT2630348	hsa-miR-4437	CLIP-seq
MIRT2113505	hsa-miR-4448	CLIP-seq
MIRT2113506	hsa-miR-4468	CLIP-seq
MIRT2630349	hsa-miR-4475	CLIP-seq
MIRT2630350	hsa-miR-4480	CLIP-seq
MIRT2630351	hsa-miR-4501	CLIP-seq
MIRT2630352	hsa-miR-4507	CLIP-seq
MIRT2113508	hsa-miR-4520a-3p	CLIP-seq
MIRT2630353	hsa-miR-4522	CLIP-seq
MIRT1553941	hsa-miR-4652-3p	CLIP-seq
MIRT2336524	hsa-miR-466	CLIP-seq
MIRT2336526	hsa-miR-4672	CLIP-seq
MIRT2630354	hsa-miR-4674	CLIP-seq
MIRT2630355	hsa-miR-4699-3p	CLIP-seq
MIRT2630356	hsa-miR-4708-3p	CLIP-seq
MIRT1379780	hsa-miR-4714-3p	CLIP-seq
MIRT2113512	hsa-miR-4717-3p	CLIP-seq
MIRT1379782	hsa-miR-4721	CLIP-seq
MIRT2336531	hsa-miR-4731-3p	CLIP-seq
MIRT2630357	hsa-miR-4733-5p	CLIP-seq
MIRT2630358	hsa-miR-4735-3p	CLIP-seq
MIRT2113513	hsa-miR-4738-3p	CLIP-seq
MIRT2113514	hsa-miR-4752	CLIP-seq
MIRT1379784	hsa-miR-4761-3p	CLIP-seq
MIRT2630359	hsa-miR-4765	CLIP-seq
MIRT2630360	hsa-miR-4766-5p	CLIP-seq
MIRT2630361	hsa-miR-4776-3p	CLIP-seq
MIRT1379786	hsa-miR-4795-3p	CLIP-seq
MIRT2113516	hsa-miR-4800-5p	CLIP-seq
MIRT2336535	hsa-miR-4801	CLIP-seq
MIRT2630362	hsa-miR-493	CLIP-seq
MIRT2630363	hsa-miR-526b	CLIP-seq
MIRT2113519	hsa-miR-564	CLIP-seq
MIRT2630364	hsa-miR-605	CLIP-seq
MIRT2113521	hsa-miR-607	CLIP-seq
MIRT2113522	hsa-miR-616	CLIP-seq
MIRT2630365	hsa-miR-629	CLIP-seq
MIRT2630366	hsa-miR-655	CLIP-seq
MIRT2113526	hsa-miR-661	CLIP-seq
MIRT2630367	hsa-miR-676	CLIP-seq
MIRT2630368	hsa-miR-760	CLIP-seq
MIRT2630369	hsa-miR-767-3p	CLIP-seq
MIRT2336501	hsa-miR-1193	CLIP-seq
MIRT2113479	hsa-miR-1305	CLIP-seq
MIRT1553941	hsa-miR-4652-3p	CLIP-seq
MIRT2113512	hsa-miR-4717-3p	CLIP-seq
MIRT1379811	hsa-miR-105	CLIP-seq
MIRT2336501	hsa-miR-1193	CLIP-seq
MIRT2630319	hsa-miR-1224-3p	CLIP-seq
MIRT1379731	hsa-miR-1233	CLIP-seq
MIRT2691783	hsa-miR-1254	CLIP-seq
MIRT2630320	hsa-miR-1260	CLIP-seq
MIRT2630321	hsa-miR-1260b	CLIP-seq
MIRT2630322	hsa-miR-1280	CLIP-seq
MIRT1379812	hsa-miR-1294	CLIP-seq
MIRT2630325	hsa-miR-181a	CLIP-seq
MIRT2630326	hsa-miR-181b	CLIP-seq
MIRT2630327	hsa-miR-181c	CLIP-seq
MIRT2630328	hsa-miR-181d	CLIP-seq
MIRT2630329	hsa-miR-18a	CLIP-seq
MIRT2630330	hsa-miR-18b	CLIP-seq
MIRT1379745	hsa-miR-216b	CLIP-seq
MIRT2691784	hsa-miR-3116	CLIP-seq
MIRT2691785	hsa-miR-3126-3p	CLIP-seq
MIRT2113485	hsa-miR-3138	CLIP-seq
MIRT2630335	hsa-miR-3194-3p	CLIP-seq
MIRT2691786	hsa-miR-3194-5p	CLIP-seq
MIRT2113493	hsa-miR-3622a-5p	CLIP-seq
MIRT2336512	hsa-miR-3647-3p	CLIP-seq
MIRT2630336	hsa-miR-3671	CLIP-seq
MIRT2113497	hsa-miR-3675-3p	CLIP-seq
MIRT2336513	hsa-miR-3692	CLIP-seq
MIRT2630339	hsa-miR-3907	CLIP-seq
MIRT2336514	hsa-miR-3941	CLIP-seq
MIRT2630342	hsa-miR-3942-3p	CLIP-seq
MIRT2691787	hsa-miR-4261	CLIP-seq
MIRT2630344	hsa-miR-4262	CLIP-seq
MIRT2113501	hsa-miR-4269	CLIP-seq
MIRT2336516	hsa-miR-4282	CLIP-seq
MIRT2113502	hsa-miR-4289	CLIP-seq
MIRT1379836	hsa-miR-4316	CLIP-seq
MIRT2630347	hsa-miR-4436b-3p	CLIP-seq
MIRT2113506	hsa-miR-4468	CLIP-seq
MIRT2630349	hsa-miR-4475	CLIP-seq
MIRT2630350	hsa-miR-4480	CLIP-seq
MIRT2630351	hsa-miR-4501	CLIP-seq
MIRT2113508	hsa-miR-4520a-3p	CLIP-seq
MIRT1553941	hsa-miR-4652-3p	CLIP-seq
MIRT2336524	hsa-miR-466	CLIP-seq
MIRT2336526	hsa-miR-4672	CLIP-seq
MIRT2630355	hsa-miR-4699-3p	CLIP-seq
MIRT2113512	hsa-miR-4717-3p	CLIP-seq
MIRT2336531	hsa-miR-4731-3p	CLIP-seq
MIRT2630357	hsa-miR-4733-5p	CLIP-seq
MIRT2630358	hsa-miR-4735-3p	CLIP-seq
MIRT2113513	hsa-miR-4738-3p	CLIP-seq
MIRT2113514	hsa-miR-4752	CLIP-seq
MIRT1379784	hsa-miR-4761-3p	CLIP-seq
MIRT2630359	hsa-miR-4765	CLIP-seq
MIRT2630360	hsa-miR-4766-5p	CLIP-seq
MIRT2630361	hsa-miR-4776-3p	CLIP-seq
MIRT2691788	hsa-miR-4782-5p	CLIP-seq
MIRT2113516	hsa-miR-4800-5p	CLIP-seq
MIRT2336535	hsa-miR-4801	CLIP-seq
MIRT1379788	hsa-miR-487b	CLIP-seq
MIRT2630362	hsa-miR-493	CLIP-seq
MIRT2630363	hsa-miR-526b	CLIP-seq
MIRT2113519	hsa-miR-564	CLIP-seq
MIRT2691789	hsa-miR-583	CLIP-seq
MIRT2630364	hsa-miR-605	CLIP-seq
MIRT2113521	hsa-miR-607	CLIP-seq
MIRT2113522	hsa-miR-616	CLIP-seq
MIRT2630367	hsa-miR-676	CLIP-seq
MIRT2630369	hsa-miR-767-3p	CLIP-seq
MIRT2691790	hsa-miR-875-3p	CLIP-seq
MIRT1553941	hsa-miR-4652-3p	CLIP-seq
MIRT2113512	hsa-miR-4717-3p	CLIP-seq

Show/Hide all (66)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001503	Process	Ossification	IEA
GO:0005515	Function	Protein binding	IPI	10085125, 11390366, 14985763, 16787399, 18687776, 19122660, 20584990, 20676133, 21092856, 21102451, 21949853, 22431521, 23236149, 23283322, 24070898, 24128306, 25401472, 28541286, 32296183, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005764	Component	Lysosome	IDA	28541286
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	11331584
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA	11331584, 16787399, 18817523
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	11331584
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	14985763
GO:0005905	Component	Clathrin-coated pit	IDA	11331584
GO:0006622	Process	Protein targeting to lysosome	IEA
GO:0006895	Process	Golgi to endosome transport	IBA
GO:0006895	Process	Golgi to endosome transport	IDA	11331584
GO:0006897	Process	Endocytosis	IBA
GO:0006897	Process	Endocytosis	IDA	10085125, 11331584, 21092856
GO:0006897	Process	Endocytosis	IEA
GO:0006897	Process	Endocytosis	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IMP	18258592
GO:0007218	Process	Neuropeptide signaling pathway	IDA	9756851
GO:0008333	Process	Endosome to lysosome transport	IDA	11331584
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IDA	14985763
GO:0009986	Component	Cell surface	IDA	10085125
GO:0010008	Component	Endosome membrane	IDA	18817523
GO:0010008	Component	Endosome membrane	IEA
GO:0010465	Function	Nerve growth factor receptor activity	IDA	14985763
GO:0010468	Process	Regulation of gene expression	IMP	18258592
GO:0014902	Process	Myotube differentiation	IEA
GO:0014902	Process	Myotube differentiation	IMP	18258592
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IDA	15992544
GO:0016020	Component	Membrane	IEA
GO:0016050	Process	Vesicle organization	IBA
GO:0016050	Process	Vesicle organization	IDA	15992544
GO:0016050	Process	Vesicle organization	IEA
GO:0019899	Function	Enzyme binding	IPI	10085125
GO:0030136	Component	Clathrin-coated vesicle	IDA	11331584
GO:0030140	Component	Trans-Golgi network transport vesicle	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030379	Function	Neurotensin receptor activity, non-G protein-coupled	IDA	9756851
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IDA	9756851
GO:0031965	Component	Nuclear membrane	IEA
GO:0032509	Process	Endosome transport via multivesicular body sorting pathway	IDA	11331584
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0032868	Process	Response to insulin	IEA
GO:0032868	Process	Response to insulin	IMP	15992544
GO:0038180	Process	Nerve growth factor signaling pathway	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0046323	Process	D-glucose import	IEA
GO:0046323	Process	D-glucose import	IMP	15992544
GO:0048011	Process	Neurotrophin TRK receptor signaling pathway	IMP	14985763
GO:0048227	Process	Plasma membrane to endosome transport	IDA	11331584
GO:0048406	Function	Nerve growth factor binding	IPI	14985763
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	11331584
GO:0090160	Process	Golgi to lysosome transport	IDA	16787399
GO:0099558	Process	Maintenance of synapse structure	IEA
GO:0150053	Component	Cerebellar climbing fiber to Purkinje cell synapse	IEA
GO:1905394	Function	Retromer complex binding	IDA	18817523

MIM	HGNC	e!Ensembl
602458	11186	ENSG00000134243

Q99523

Protein name

Sortilin (100 kDa NT receptor) (Glycoprotein 95) (Gp95) (Neurotensin receptor 3) (NT3) (NTR3)

Protein function

Functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Required for protein transport from the Golgi apparatus to the lysosomes by a pathway that is independent of the mannose-6-phosphate recept

PDB

3F6K , 3G2U , 3G2V , 4MSL , 4N7E , 4PO7 , 5MRH , 5MRI , 6EHO , 6X3L , 6X48 , 6X4H , 8T8R , 8T8S

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15902	Sortilin-Vps10	142 → 572	Sortilin, neurotensin receptor 3,	Domain
PF15901	Sortilin_C	574 → 740	Sortilin, neurotensin receptor 3, C-terminal	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain and prostate (at protein level). Expressed at high levels in brain, spinal cord, heart, skeletal muscle, thyroid, placenta and testis. Expressed at lower levels in lymphoid organs, kidney, colon and liver. {ECO:00002

Sequence

MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRWSGPIGVSWGL
RAAAAGGAFPRGGRWRRSAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDS
TGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSG
KVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLW
VSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIG
VKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDM
VFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLS
EDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLS
EPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHS
SRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSY
TIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVT
KQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPG
DKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKK
YVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE

Sequence length

831

Interactions

View interactions

	KEGG		Reactome
	Lysosome Neurotrophin signaling pathway Cholesterol metabolism		Golgi Associated Vesicle Biogenesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LOW DENSITY LIPOPROTEIN CHOLESTEROL LEVEL QUANTITATIVE TRAIT LOCUS 6	association	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SORT1-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (136)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenoma	Adenoma	BEFREE	18624930, 29037860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	18624930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18938222, 23595767, 23673467, 27392867, 30909233	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Alzheimer disease	Pubtator	21245145	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Alzheimer disease	Pubtator	27392867	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	21245145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29690919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22361451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	22361451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30454027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	23535823, 25198969, 37893562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	23535823, 24842835, 25198969, 26352243, 28698188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	28356268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	24674750, 25401472, 25702058, 27312323, 28742217, 29097363, 29191923, 29196163, 30634965, 30666202, 30950489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35309353	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24674750, 25101658, 25401472, 25702058, 27312323, 28742217, 29097363, 29191923, 29196163, 30634965, 30666202, 30950489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	30634965	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31320306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	15583009	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Injuries	Brain injuries	Pubtator	26297037	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22128158, 30454027, 30771434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25871389, 33618683, 34428050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28433812, 29272741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	25871389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36445845, 37673328	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	38114725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	25871389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29055389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27120782	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	29802376	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37562257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	23910371, 25042869, 25702058, 27312221, 27392867, 28742217, 29191923, 29899496		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	CTD_human_DG	25805502		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	27392867, 28279970	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Ischemic stroke	Pubtator	26464717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ceroid lipofuscinosis neuronal 5	Neuronal ceroid lipofuscinosis	Pubtator	22431521	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	24162799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	27881673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	27881673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	CTD_human_DG	28453831		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21966426, 27834811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18462017, 19660754, 24500115, 24674750, 25870159, 25887678, 27112212, 27846466, 28728579, 30634965		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	21378990		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	18462017, 19660754, 19837406, 22476029, 23050023, 23364394, 24500115, 24674750, 25870159, 25887678, 26464717, 27112212, 27846466, 28705542, 28728579, 30946050 View all (1 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	21378990		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	23050023, 24674750, 26464717, 28728579, 30634965, 32685059, 34767831	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease Autosomal Dominant 1	Coronary artery disease	Pubtator	22216278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	21804106, 22152955, 27112212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	18462017, 19660754, 21804106, 22152955, 24500115, 24674750, 25870159, 25887678, 27112212, 27846466		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corticobasal Degeneration	Corticobasal degeneration	Pubtator	40545554	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	26556286, 27834811, 28478778, 29499509, 30127743, 30670975, 31493120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23904453, 24986865, 28450454, 30697159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23904453, 24986865, 28450454, 28728579, 30697159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	27322064, 28728579, 37762628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27322064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23904453, 28945101, 29191923, 30634965, 30666202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	39884388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	23904453, 24986865, 27846466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	37582372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	26297037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Tremor	Essential tremor	Pubtator	26297037	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	23904453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28453831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	21092856, 29555433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	24163244, 29555433, 39185427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	31766750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	25418464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30814514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	39185427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30814514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23576602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23576602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Heart valve disease	Pubtator	28356268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	31450785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	20816088, 28919240, 30670473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	27980238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	28945101, 30670473, 30950489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	23102784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31062082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	26464717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	34767831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	28945101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	38302188	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	24223945	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30670975, 31493120		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	22128158, 30454027, 30771434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	30741921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29055389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	9196438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25365768, 28433812, 30770901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29037860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23576602, 29382723, 30454027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	23869086	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18305571, 35457078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	37562257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	26556286, 27834811, 28478778, 29499509, 30127743, 30670975, 31493120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29191923, 30697159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	35692878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucolipidoses	Mucolipidosis	Pubtator	32357547	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	26566674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	19837406, 20826839, 21463265, 22144573, 23910371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	20839009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23576602		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29067536, 29191923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	34360553, 39389992, 8795581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	21358643, 23934644, 28282920, 28798232, 30666202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	29272741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	24162799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28945101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19219422, 22466652, 23904453, 24986865, 26375028, 28236654, 28844948, 29899496, 30666202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26375028, 27322064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24067459	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	32526166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	32210219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	26375028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	30634965	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	30634965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	30634965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	29555433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25365768, 28433812, 30770901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25365768, 26473288, 36089417, 37596305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28433812	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22701684	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	38302188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	26839058		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Senile Plaques	Senile Plaques	BEFREE	29690919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	15817657	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	23904453, 30670473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12854135	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37579183	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29037860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29037860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	29037860	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	31493120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	28279970	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	24251769		★★★★★ ★☆☆☆☆ Found in Text Mining only

SORT1 (sortilin 1)