BDNF (brain derived neurotrophic factor)

Gene

• Entrez ID: 627
• Gene name: Brain derived neurotrophic factor
• Gene symbol: BDNF
• Synonyms (NCBI Gene): ANON2, BULN2
• Chromosome: 11
• Chromosome location: 11p14.1
• Summary: This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001946	hsa-miR-30a-5p	Luciferase reporter assay	18632683
MIRT003153	hsa-miR-210-3p	2DGE, immunoprecipitaion, Luciferase reporter assay, Mass spectrometry, Microarray, qRT-PCR, Western blot	19826008
MIRT002955	hsa-miR-1-3p	Luciferase reporter assay	14697198
MIRT005900	hsa-miR-22-3p	Luciferase reporter assay, Microarray	21168126
MIRT054501	hsa-miR-182-5p	qRT-PCR, Western blotting	23704927
MIRT054502	hsa-miR-132-3p	qRT-PCR, Western blotting	23704927
MIRT437447	hsa-miR-204-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23285024
MIRT437463	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	24026226
MIRT000362	hsa-miR-124-3p	LacZ reporter assay	23601049
MIRT438353	hsa-miR-206	Flow, qRT-PCR	24855559
MIRT438353	hsa-miR-206	Flow, qRT-PCR	24855559
MIRT732282	hsa-miR-1-5p	Luciferase reporter assay, qRT-PCR, Western blot	27381812
MIRT732282	hsa-miR-1-5p	Luciferase reporter assay, qRT-PCR, Western blot	27381812
MIRT732282	hsa-miR-1-5p	Luciferase reporter assay, qRT-PCR, Western blot	27381812
MIRT732282	hsa-miR-1-5p	Luciferase reporter assay, qRT-PCR, Western blot	27381812
MIRT054501	hsa-miR-182-5p	Luciferase reporter assay, qRT-PCR	25955435
MIRT054501	hsa-miR-182-5p	Luciferase reporter assay, qRT-PCR	25955435
MIRT735361	hsa-miR-10a-5p	Luciferase reporter assay, qRT-PCR	28112253
MIRT437447	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	25962115
MIRT003153	hsa-miR-210-3p	Luciferase reporter assay, qRT-PCR, Western blot	26708520
MIRT003153	hsa-miR-210-3p	Luciferase reporter assay, qRT-PCR, Western blot	26708520
MIRT438353	hsa-miR-206	Microarray	32041109
MIRT733089	hsa-miR-155-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33511575
MIRT733831	hsa-miR-202-3p	Luciferase reporter assay, qRT-PCR, Western blotting	32425535
MIRT735361	hsa-miR-10a-5p	Luciferase reporter assay, Western blotting, RNA-seq, qRT-PCR	32291635
MIRT755327	hsa-miR-134-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	38579169
MIRT437447	hsa-miR-204-5p	Western blotting, qRT-PCR	35158801
MIRT820502	hsa-miR-1827	CLIP-seq
MIRT820503	hsa-miR-2467-3p	CLIP-seq
MIRT820504	hsa-miR-4257	CLIP-seq
MIRT820505	hsa-miR-4316	CLIP-seq
MIRT820506	hsa-miR-4698	CLIP-seq
MIRT820507	hsa-miR-4710	CLIP-seq
MIRT820508	hsa-miR-940	CLIP-seq
MIRT820509	hsa-miR-147b	CLIP-seq
MIRT820510	hsa-miR-155	CLIP-seq
MIRT820511	hsa-miR-2053	CLIP-seq
MIRT820512	hsa-miR-210	CLIP-seq
MIRT820513	hsa-miR-2861	CLIP-seq
MIRT820514	hsa-miR-3192	CLIP-seq
MIRT820515	hsa-miR-3617	CLIP-seq
MIRT820516	hsa-miR-365	CLIP-seq
MIRT820517	hsa-miR-3689a-3p	CLIP-seq
MIRT820518	hsa-miR-3689c	CLIP-seq
MIRT820519	hsa-miR-3689d	CLIP-seq
MIRT820520	hsa-miR-382	CLIP-seq
MIRT820521	hsa-miR-3940-5p	CLIP-seq
MIRT820522	hsa-miR-4314	CLIP-seq
MIRT820523	hsa-miR-4446-5p	CLIP-seq
MIRT820524	hsa-miR-4507	CLIP-seq
MIRT820525	hsa-miR-452	CLIP-seq
MIRT820526	hsa-miR-4676-3p	CLIP-seq
MIRT820527	hsa-miR-4728-5p	CLIP-seq
MIRT820528	hsa-miR-4755-5p	CLIP-seq
MIRT820529	hsa-miR-4781-5p	CLIP-seq
MIRT820530	hsa-miR-641	CLIP-seq
MIRT820531	hsa-miR-661	CLIP-seq
MIRT820532	hsa-miR-744	CLIP-seq
MIRT820533	hsa-miR-933	CLIP-seq
MIRT820534	hsa-miR-943	CLIP-seq
MIRT820535	hsa-miR-129-5p	CLIP-seq
MIRT820511	hsa-miR-2053	CLIP-seq
MIRT820536	hsa-miR-3170	CLIP-seq
MIRT820515	hsa-miR-3617	CLIP-seq
MIRT820537	hsa-miR-3976	CLIP-seq
MIRT820538	hsa-miR-4260	CLIP-seq
MIRT820539	hsa-miR-4277	CLIP-seq
MIRT820540	hsa-miR-4307	CLIP-seq
MIRT820541	hsa-miR-579	CLIP-seq
MIRT820530	hsa-miR-641	CLIP-seq
MIRT820542	hsa-miR-889	CLIP-seq
MIRT1921408	hsa-miR-2355-5p	CLIP-seq
MIRT1921409	hsa-miR-3124-3p	CLIP-seq
MIRT1921410	hsa-miR-339-5p	CLIP-seq
MIRT1921411	hsa-miR-3675-3p	CLIP-seq
MIRT1921412	hsa-miR-3679-3p	CLIP-seq
MIRT1921413	hsa-miR-4648	CLIP-seq
MIRT1921414	hsa-miR-4654	CLIP-seq
MIRT1921415	hsa-miR-4684-5p	CLIP-seq
MIRT1921416	hsa-miR-4769-5p	CLIP-seq
MIRT1942471	hsa-miR-3120-3p	CLIP-seq
MIRT1942472	hsa-miR-583	CLIP-seq
MIRT820511	hsa-miR-2053	CLIP-seq
MIRT2181283	hsa-miR-3163	CLIP-seq
MIRT2181284	hsa-miR-4282	CLIP-seq
MIRT2181285	hsa-miR-4789-5p	CLIP-seq
MIRT2464905	hsa-miR-3922-5p	CLIP-seq
MIRT2464906	hsa-miR-3925-5p	CLIP-seq
MIRT820537	hsa-miR-3976	CLIP-seq
MIRT2464907	hsa-miR-4717-5p	CLIP-seq
MIRT2464908	hsa-miR-4753-5p	CLIP-seq
MIRT2484554	hsa-miR-3180-5p	CLIP-seq
MIRT2484555	hsa-miR-514	CLIP-seq
MIRT2484556	hsa-miR-514b-3p	CLIP-seq
MIRT2484557	hsa-miR-520a-5p	CLIP-seq
MIRT2484558	hsa-miR-525-5p	CLIP-seq
MIRT2484559	hsa-miR-616	CLIP-seq
MIRT2484560	hsa-miR-642b	CLIP-seq
MIRT2484561	hsa-miR-646	CLIP-seq
MIRT2675914	hsa-miR-125a-3p	CLIP-seq
MIRT2675915	hsa-miR-138	CLIP-seq
MIRT2675916	hsa-miR-140-3p	CLIP-seq
MIRT2675917	hsa-miR-1587	CLIP-seq
MIRT2675918	hsa-miR-203	CLIP-seq
MIRT2675919	hsa-miR-205	CLIP-seq
MIRT2675920	hsa-miR-3064-3p	CLIP-seq
MIRT1942471	hsa-miR-3120-3p	CLIP-seq
MIRT2675921	hsa-miR-3143	CLIP-seq
MIRT2675922	hsa-miR-3179	CLIP-seq
MIRT2484554	hsa-miR-3180-5p	CLIP-seq
MIRT2675923	hsa-miR-34c-3p	CLIP-seq
MIRT2675924	hsa-miR-3691-3p	CLIP-seq
MIRT2675925	hsa-miR-3934	CLIP-seq
MIRT820504	hsa-miR-4257	CLIP-seq
MIRT2675926	hsa-miR-4311	CLIP-seq
MIRT2675927	hsa-miR-4420	CLIP-seq
MIRT2675928	hsa-miR-4477b	CLIP-seq
MIRT2675929	hsa-miR-4492	CLIP-seq
MIRT2675930	hsa-miR-4498	CLIP-seq
MIRT2675931	hsa-miR-451b	CLIP-seq
MIRT2675932	hsa-miR-4643	CLIP-seq
MIRT2675933	hsa-miR-4656	CLIP-seq
MIRT2675934	hsa-miR-4675	CLIP-seq
MIRT2675935	hsa-miR-4696	CLIP-seq
MIRT2675936	hsa-miR-4741	CLIP-seq
MIRT2675937	hsa-miR-4786-5p	CLIP-seq
MIRT2675938	hsa-miR-4790-3p	CLIP-seq
MIRT2675939	hsa-miR-5096	CLIP-seq
MIRT2484557	hsa-miR-520a-5p	CLIP-seq
MIRT2484558	hsa-miR-525-5p	CLIP-seq
MIRT2675940	hsa-miR-543	CLIP-seq
MIRT2484559	hsa-miR-616	CLIP-seq
MIRT2484560	hsa-miR-642b	CLIP-seq
MIRT2675941	hsa-miR-762	CLIP-seq
MIRT2675942	hsa-miR-764	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Activation	11719924
REST	Repression	18075316;18518926

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005163	Function	Nerve growth factor receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	7703225, 10631974, 25241761, 29997244, 32296183, 32814053, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	ISS
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007399	Process	Nervous system development	TAS	2236018
GO:0007411	Process	Axon guidance	TAS	19036963
GO:0007416	Process	Synapse assembly	IDA	19036963
GO:0008021	Component	Synaptic vesicle	IBA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	2236018
GO:0010832	Process	Negative regulation of myotube differentiation	ISS
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0021675	Process	Nerve development	IBA
GO:0030424	Component	Axon	IBA
GO:0030425	Component	Dendrite	IBA
GO:0031547	Process	Brain-derived neurotrophic factor receptor signaling pathway	TAS	19036963
GO:0031550	Process	Positive regulation of brain-derived neurotrophic factor receptor signaling pathway	TAS	19036963
GO:0038180	Process	Nerve growth factor signaling pathway	IBA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048668	Process	Collateral sprouting	IDA	19036963
GO:0048672	Process	Positive regulation of collateral sprouting	IDA	19036963
GO:0048812	Process	Neuron projection morphogenesis	IBA
GO:0050804	Process	Modulation of chemical synaptic transmission	IBA
GO:0051965	Process	Positive regulation of synapse assembly	IDA	19036963
GO:2000008	Process	Regulation of protein localization to cell surface	TAS	12130635
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	ISS

Other IDs

• MIM: 113505
• HGNC: 1033
• e!Ensembl: ENSG00000176697

Protein

• UniProt ID: P23560
• Protein name: Neurotrophic factor BDNF precursor form (proBDNF) (Abrineurin) (Brain-derived neurotrophic factor) [Cleaved into: Neurotrophic factor BDNF]
• Protein function: Important signaling molecule that activates signaling cascades downstream of NTRK2 (PubMed:11152678). During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. P
• PDB: 1B8M, 1BND
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00243	NGF	133 → 246	Nerve growth factor family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in blood plasma and in saliva (at protein level) (PubMed:11152678, PubMed:19467646). Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, pro
• Sequence:

  MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLA
  DTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAA
  NMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQY
  FYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCT
  LTIKRGR

• Sequence length: 247

Pathways

KEGG:

MAPK signaling pathway
Ras signaling pathway
cAMP signaling pathway
PI3K-Akt signaling pathway
Neurotrophin signaling pathway
Huntington disease
Pathways of neurodegeneration - multiple diseases
Cocaine addiction
Alcoholism

Reactome:

Activated NTRK2 signals through PLCG1
Activated NTRK2 signals through FRS2 and FRS3
NTRK2 activates RAC1

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Obesity	Likely pathogenic	rs1852795747	RCV001261409	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BDNF-related disorder	Uncertain significance; Likely benign; Conflicting classifications of pathogenicity; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BODY WEIGHT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CCHS WITH HIRSCHSPRUNG DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR BLINDNESS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital central hypoventilation	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CONGENITAL CENTRAL HYPOVENTILATION SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGESTIVE SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, TONIC-CLONIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOXIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Memory impairment, susceptibility to	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL RETARDATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MORBID OBESITY	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY, MORBID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSONIAN DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP APNEA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP APNEA, OBSTRUCTIVE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TONIC-CLONIC EPILEPSY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Variant of unknown significance	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WAGR SYNDROME	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acne	Acne	BEFREE	30980616, 31234814		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	30980616, 31234814		★☆☆☆☆ Found in Text Mining only
Acoustic Neuroma	Acoustic Neuroma	BEFREE	19937367		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	BEFREE	24523540, 25241287, 30826210		★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	17344400		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	26313133, 26795846, 29062839, 30380818, 31255678		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	16173964, 22652301		★☆☆☆☆ Found in Text Mining only
Acute schizophrenia	Schizophrenia	BEFREE	28671000, 29392373		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	26926340		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16862449, 24982195		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	15948150		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	29037860		★☆☆☆☆ Found in Text Mining only
Adjustment Disorders	Adjustment Disorders	BEFREE	31197968		★☆☆☆☆ Found in Text Mining only
Adrenal cortical hypofunction	Adrenal Cortical Hypofunction	BEFREE	31231276		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	30656694		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	19716854		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	17550129, 19642024, 26614346, 29344238, 7809137		★☆☆☆☆ Found in Text Mining only
Adult-Onset Dystonias	Dystonia	BEFREE	24925604		★☆☆☆☆ Found in Text Mining only
Affective Disorders, Psychotic	Affective Psychosis	BEFREE	23429848, 27501933		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	28664762, 30025135, 30871541		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	31450992		★☆☆☆☆ Found in Text Mining only
Agoraphobia	Agoraphobia	BEFREE	15118353		★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	31792359		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	21723144, 25649076		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	12358753, 15935057, 16565926, 16649215, 17293537, 18786162, 18830724, 19542613, 20345896, 20613678, 20967212, 21605064, 21951954, 23924085, 24086677, 24384148, 24475133, 25024337, 25364831, 25772071, 25853819, 26059363, 26923413, 27494844, 27521573, 28322202, 28468845, 28498887, 28720165, 30014553, 30899092, 30909233, 31348306, 31349032, 31745181, 33369083, 33646145, 34267235, 34668150, 34831318, 35099506, 35599479, 36473250, 36498925, 36530083, 36979505, 37287291, 37658429, 37759083, 37948982, 38232788, 38279143, 38417853, 38454193, 39210294	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17344400, 19412541, 20164549, 20377991, 24276217, 26410307, 26819457, 28164772, 28569173, 36170028, 36498925	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	17344400		★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	19661618, 28341039, 28971775		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	11244490, 14997020, 15843069, 25853819, 28569173, 31102717, 31771052		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	17344400		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	17344400		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	17344400		★☆☆☆☆ Found in Text Mining only
Ambiguous Genitalia	Ambiguous Genitalia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	15635706, 23313493, 26410307, 28720165, 28840059, 29370115, 29535375, 30326283, 30618722, 30968880, 31250384, 31381511		★☆☆☆☆ Found in Text Mining only
Amnesia, Transient Global	Amnesia	BEFREE	18692116		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	21151024, 23599427, 23769397, 24112792, 25026432, 25484286, 26402627, 28072416, 28132883, 28336494, 28468845, 28720165, 29714500, 30397132, 30483749, 30586546, 31013457, 31037648, 31812977		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	10202982, 10786708, 12429188, 21706386, 22735487, 24475283, 25311268, 27617773, 28228570, 28373073, 28539884, 28698670, 29247376, 29858777, 30929165, 31646358, 31817487		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	29702606, 30572951	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	28539884		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30133147		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	31359356, 31656724		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	BEFREE	22223335		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	31736231		★☆☆☆☆ Found in Text Mining only
Angelman Syndrome	Angelman Syndrome	BEFREE	26219744, 31849603		★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	19013140		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	Pubtator	23240009, 26775293, 29595641, 34325733	Associate	★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	29126980, 29717802, 29882089		★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	Pubtator	18753648	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29249692		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	15115760, 17376155, 24292283		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	Pubtator	17376155, 34856753	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	12888803, 15115760, 15657604, 15838534, 17197106, 17376155, 18855537, 19931559, 20946355, 21936709, 21945389, 22127997, 24831852, 27271855, 30355978, 30804742		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	LHGDN	12888803, 15657604, 17376155, 17435670, 17621170		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia nervosa	Pubtator	17197106, 17376155, 27271855	Associate	★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	17200667, 28810156		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	12967770, 15118353, 15770238, 15913870, 15918078, 17226799, 17726474, 17850220, 17941097, 19088493, 19153574, 19423950, 19582565, 19931400, 20213725, 20302894, 20478625, 20515664, 20621121, 21097659, 21126736, 21290143, 21596481, 21839144, 22044630, 22950914, 23168995, 23221871, 23357445, 24021960, 24051499, 24155299, 25001952, 25383981, 25422959, 25498133, 25618300, 25640836, 26037856, 26649946, 26705390, 26773399, 27742526, 27932530, 28056040, 28077306, 28257759, 28413930, 28445707, 28694775, 29084453, 29302747, 29512848, 29805780, 30072053, 30098276, 30134233, 30269521, 30448423, 30465752, 30661931, 30711709, 30714802, 30798429, 30803507, 30850750, 30882674, 30911352, 31265872, 31368178, 31722379		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	19582565, 19931400, 21839144, 23357445, 25425456, 25618300, 26649946, 27005989, 27176146, 28413930, 28416813, 28933046, 29595641, 30711709, 30988377, 32859253, 33932264, 34425486, 35743044, 38255861	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	GWASCAT_DG	29942085		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	33673283	Inhibit	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	12967770, 15118353, 15770238, 15913870, 15918078, 17226799, 17726474, 17850220, 17941097, 18602452, 18603005, 19088493, 19153574, 19423950, 19582565, 19931400, 20075215, 20213725, 20302894, 20478625, 20515664, 20621121, 21097659, 21126736, 21290143, 21596481, 21616543, 21839144, 22044630, 22950914, 23026378, 23168995, 23221871, 23357445, 24021960, 24051499, 24155299, 25001952, 25422959, 25498133, 25618300, 25640836, 26037856, 26649946, 26705390, 26773399, 27742526, 27932530, 28056040, 28077306, 28257759, 28413930, 28445707, 28694775, 29084453, 29288745, 29302747, 29512848, 29805780, 30017710, 30072053, 30078664, 30098276, 30134233, 30269521, 30402941, 30448423, 30465752, 30661931, 30711709, 30714802, 30798429, 30803507, 30850750, 30882674, 30911352, 30967530, 31103845, 31265872, 31368178, 31568835, 31611000, 31722379		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	19931400, 21839144, 24247044, 25425456, 25618300, 34425486	Associate	★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	BEFREE	30150003, 31756156		★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	Pubtator	30150003, 31756156, 35428413, 40658687	Associate	★☆☆☆☆ Found in Text Mining only
Apraxias	Apraxia	Pubtator	23303061, 33407685, 35459929	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29126980, 29375397, 29753231		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19490633, 22046267, 22715356	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33673283	Stimulate	★☆☆☆☆ Found in Text Mining only
Asperger Syndrome	Asperger Syndrome	BEFREE	30033880		★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	Pubtator	33746583	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12752594, 15544837, 15710474, 17584309, 19237390, 19295238, 19895626, 21723144, 22468730, 23461616, 24560686, 24863266, 25335167, 25945802, 26289094, 26504195, 26662416, 27176146, 28522569, 29047096, 29217995, 30189218, 30351991		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	12900521, 17584309		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	12900521, 25945802, 26566264, 26662416, 27176146, 27317689, 28522569, 33068389	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	15138791, 17635673, 17971243, 29391888		★☆☆☆☆ Found in Text Mining only
Asymmetric Septal Hypertrophy	Septal Hypertrophy	BEFREE	28253924		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	26926340	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28760212		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	28760212, 34580389, 35666604	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	27979044, 28164772		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	28164772	Inhibit	★☆☆☆☆ Found in Text Mining only
ATRIAL SEPTAL DEFECT 1	Atrial Septal Defect	BEFREE	26999419, 29532458		★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	BEFREE	26999419, 29532458		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	16740142, 18786162, 24475133, 27521573, 30909233, 34933635, 37948982	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	21466746		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	19582565, 20943059, 21466746, 21733227, 22362486, 25425456, 28630479	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	15940292, 16919891, 16996699, 17044097, 17216343, 17219016, 17427194, 17918236, 18286632, 18428117, 19270759, 19603419, 19721846, 20691787, 20943059, 21063237, 21466746, 21733227, 22825876, 23109089, 23972692, 24713358, 25354496, 25425456, 25950609, 27209073, 27457811, 27561780, 27807606, 27919646, 28249186, 28293263, 28630479, 28710695, 28751869, 29132072, 31010680, 31170860, 31269890, 31480710, 31745072		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	LHGDN	15940292		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorder	Autism	Pubtator	19582565, 23517654, 26485544, 29369497, 34030059, 34546355	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorder	Autism	Pubtator	31591381	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorder	Autism	Pubtator	34518555	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	19582565, 23517654, 25535174, 25669997, 26485544, 26728085, 26820673, 26999419, 27506602, 28138831, 28335658, 28360521, 28500650, 28551754, 28735747, 28751869, 29073621, 29532458, 29691724, 30033880, 31591381, 31760580		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	CTD_human_DG	24781735		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	15893122, 17349978, 17380209, 18203167, 19096215, 19238500, 19582215, 20201430, 20662941, 22437340, 23517654, 23911220, 26706021, 27501933, 28138831, 29274743, 29935919, 30033880, 30975733, 31036753, 31275178, 31577039, 31787877		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	17349978, 20662941		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	19582215, 20662941, 23517654	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31255912		★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	28549782		★☆☆☆☆ Found in Text Mining only
Avoidant Restrictive Food Intake Disorder	Avoidant restrictive food intake disorder	Pubtator	20573217	Associate	★☆☆☆☆ Found in Text Mining only
Awakening Epilepsy	Epilepsy	CTD_human_DG	15282290		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	36589848	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	24112792, 28273832, 28360521, 28963051, 29464986, 29576796, 29925225, 31642818		★☆☆☆☆ Found in Text Mining only
Bedwetting	Nocturnal enuresis	BEFREE	30981636		★☆☆☆☆ Found in Text Mining only
Behavior Disorders	Behavior Disorders	BEFREE	27611068, 31279955		★☆☆☆☆ Found in Text Mining only
Benign Rolandic Epilepsy	Benign Rolandic Epilepsy	BEFREE	25301525		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	12140781, 12161822, 12524161, 14609502, 14735135, 15274036, 15336520, 15384083, 15543516, 15744031, 15948763, 15952869, 16005437, 16025419, 16152572, 16388065, 16472361, 16538178, 16568151, 16741941, 17012654, 17143075, 17239400, 17417060, 17680923, 17885603, 18242852, 18335055, 18606495, 18657242, 18664999, 18787660, 18843195, 19018231, 19018715, 19167700, 19193231, 19295510, 19330778, 19330793, 20142305, 20172611, 20627389, 21098877, 21167606, 21688113, 21931317, 22085476, 22094229, 22353757, 22484201, 22514151, 22517381, 22548711, 22877924, 23026378, 23182421, 23315174, 23567599, 23957567, 24308275, 24398043, 24468644, 24862657, 25041243, 25106037, 25246365, 25364290, 25498133, 25539739, 26528762, 26621529, 26700405, 26870912, 27018938, 27138695, 27209073, 27236043, 27613282, 27837670, 27905499, 27957714, 28144920, 28199074, 28215308, 28339618, 28479278, 28509900, 28711724, 28754344, 28830794, 29023633, 29459824, 29656414, 30041166, 30078664, 30383306, 30808582, 30852433, 30979423, 31076186		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	12140781, 12161822, 15630410, 16538178, 16568151, 17239400, 17284422, 17895927, 18497095, 18704093		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	12161822, 16472361, 18704093, 19018231, 19193231, 19255578, 19578686, 21098877, 22353757, 22548711, 22760556, 22859933, 23182421, 23931339, 24103632, 24398043, 25476119, 26432032, 26528762, 27018938, 27063557, 27270858, 27905499, 28339618, 28509900, 28751646, 28830794, 30979423, 32438891, 33757426, 38482990	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	14708030, 19018715		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	18787660, 21223646, 24802307	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	20627389, 25106037, 25364290, 25498133, 25539739		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	16152572, 22514151, 30852433		★☆☆☆☆ Found in Text Mining only
Bipolar II disorder	Bipolar Disorder	BEFREE	22514151, 22877924, 23026378, 24103632, 30542371		★☆☆☆☆ Found in Text Mining only
Bladder neck obstruction	Bladder neck obstruction	BEFREE	30121256		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29322793, 29402794, 30387205		★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Blepharospasm	Blepharospasm	BEFREE	23816543, 30519954		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	34546355	Stimulate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	36430458	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	27458153	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	31577039		★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	34516503	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	26461908		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	12524161, 16152572, 17680923, 18242852, 19264272, 19330778, 19376528, 19626271, 19817874, 22548711, 23422958, 24308275, 24801751, 25539739, 25874530, 26700405, 29331712, 30134995		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	Pubtator	19817874, 23422958, 28371657, 32033618	Associate	★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	21577214, 28755387, 29530550, 29643001, 30775992		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	18056245, 21668081, 24406738, 30014553	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	17761923, 22188054, 22773554	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Injuries Traumatic	Brain injuries	Pubtator	21228168, 22087305, 22188054, 22708958, 24586380, 25063686, 25979196, 27110438, 27438599, 28755387, 29357818, 32024452, 33605167, 34167372, 35465864	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	12575830, 24275008, 28431607		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	19922383		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain neoplasms	Pubtator	23531103, 24519935, 27091610, 31123752, 35905534	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	24519935, 26614346, 27091610, 29179434, 31123752		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18199526, 21350004, 22210241, 22895657, 25036590, 26657794, 26967918, 27813254, 28230291, 28446206, 28554249, 28800782, 29512753, 30382534, 30550003, 31105428, 31642812		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25036590, 26289590, 26967918, 28604807, 29512753, 30550003, 32985495, 33731765, 36463760, 39198096	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29258453	Inhibit	★☆☆☆☆ Found in Text Mining only
Bronchial Diseases	Bronchial disease	Pubtator	24094526	Associate	★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial hyperreactivity	Pubtator	23258230	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	29092846		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	12524161, 16152572, 17680923, 18242852, 19264272, 19330778, 19376528, 22548711, 24308275, 25539739, 25874530, 26700405, 29331712, 30575339		★☆☆☆☆ Found in Text Mining only
Bruxism	Bruxism	Pubtator	34610834	Associate	★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	BEFREE	15115760, 16901635, 17376155, 20537407, 30677719		★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	LHGDN	15657604		★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	Pubtator	17376155	Associate	★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	15115760, 15657604, 15838534, 16901635, 17376155, 17922530, 21945389, 24801751, 24831852		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	Pubtator	17376155	Associate	★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	30220011		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	10903808		★☆☆☆☆ Found in Text Mining only
C-cell hyperplasia of thyroid	Thyroid Hyperplasia	BEFREE	10200298		★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	37047601	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26926340, 29402794, 34804639, 39412903	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	34209215	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18201274, 28459374		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21999199, 27456333, 33929972, 37679418	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29322793, 29402794, 30387205		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	29312563		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16862449, 23312550, 24560686, 24982195, 26926340, 27456333		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	18201274	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	27456333	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27120782, 33721459, 37657024	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26926340, 28604655, 32536035	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	29748024		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16935322, 18201274, 19307055, 25962115, 30608586		★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	24801982		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30133549		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	21640793, 23624487, 24289461, 25762803, 26705390, 27246986, 28549782, 28575038, 28760212, 30347685		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	28760212, 31682178, 33073606, 34580389, 35285386	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Carotid Artery Thrombosis	BEFREE	26705390		★☆☆☆☆ Found in Text Mining only
Catalepsy	Catalepsy	BEFREE	24780503		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	29120253, 29417213		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	25358868		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	29469186		★☆☆☆☆ Found in Text Mining only
Central Apnea	Apnea	BEFREE	25747962		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	21422985, 38417853	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	15118353, 21577214, 28755387, 29530550, 29643001, 30326283, 30775992, 31202861		★☆☆☆☆ Found in Text Mining only
Cerebral cortical atrophy	Cerebral cortical atrophy	BEFREE	30326283, 31202861		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	14759803, 16229956, 22729070, 27282770, 27772541, 28181779, 28343295, 28777258, 28821706, 28964752, 28982330, 29330684, 29615782, 29951932, 30688263, 31091850		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	33029116, 36916413	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	22766130, 35451419	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	29780293		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	33497355	Inhibit	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	11358448, 14759803, 17222482, 19740733, 20818776, 21143020, 21228186, 21949858, 22014446, 22221491, 22633192, 23170799, 23240009, 23399480, 23907078, 24035862, 24312581, 24523540, 24722042, 24767962, 25470006, 25817361, 25896987, 26228236, 26381810, 26487176, 26758277, 26815593, 27007747, 27071687, 27077983, 27174996, 27772541, 27815836, 27816188, 27895105, 28029607, 28181779, 28291539, 28317287, 28396009, 28487988, 28495141, 28495829, 28628592, 28656112, 28751018, 28751226, 28818006, 29067329, 29128330, 29480080, 29882126, 30074228, 30118755, 30150066, 30210424, 30317637, 30338813, 30472884, 30500428, 30522804, 30571289, 30618628, 30620251, 30639697, 30661230, 30818045, 30826210, 31038013, 31059808, 31141256, 31305597, 31356182, 31368178, 31385340, 31415765, 31635269, 31736231, 31756156, 31756514		★☆☆☆☆ Found in Text Mining only
Ceruloplasmin deficiency	Ceruloplasmin deficiency	BEFREE	21949858		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28405685, 29572178, 29989647		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28405685, 29572178, 29989647		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas Cardiomyopathy	BEFREE	30133549		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	23461616, 24863266		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	17550129, 19642024, 26614346, 29344238, 7809137		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	23874483, 25150213, 26549320, 28771226		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	23874483, 23892595, 28771226	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	20463055, 21239439		★☆☆☆☆ Found in Text Mining only
Chronic depression	Mental Depression	BEFREE	24338983		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	26739449	Associate	★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	28575744		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28575038, 29475220, 30133147		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29705266		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	9715263		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	15843147, 28744117, 30067940		★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	27145806, 35300713, 36336706	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	25587209		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	25587209	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Prostatitis with Chronic Pelvic Pain Syndrome	Prostatitis With Chronic Pelvic Pain Syndrome	BEFREE	31204623		★☆☆☆☆ Found in Text Mining only
Chronic schizophrenia	Schizophrenia	BEFREE	17987059, 29938562, 30456540, 31255950		★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	19336781	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	27062585		★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	15781040, 21269288, 9073163		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	15469390, 25523127, 28778220, 29464125, 30356026, 30692222, 31195342, 31457708		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	26972010		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne syndrome	Pubtator	26972010	Associate	★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	31142902		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type II	Cockayne Syndrome	BEFREE	26972010		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	16314887, 16603474, 21366724, 22362486, 23082852, 25153701, 25443284, 26000753, 26280836, 27221213, 27807606, 28065587, 28132883, 28158153, 28402427, 28506823, 28769792, 28979677, 29090669, 29423073, 29518527, 29520217, 29574629, 29715537, 29723552, 30031883, 30315904, 30346599, 30612279, 30621666, 30717153, 30806012, 31036753, 31040784, 31841155, 31841660		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	16606648, 16818862, 17130481, 17344400, 17973920, 19412541, 20141627, 20613678, 21695421, 21951954, 22362486, 23517654, 23785422, 24086677, 25288138, 26289590, 26708060, 26806863, 26819457, 26923413, 28099630, 28164772, 28468845, 28947280, 29258453, 29480189, 29952080, 30659208, 30806012, 30899092, 30909233, 31504225, 32397876, 32985495, 32996114, 33047489, 33558459, 33646145, 33731765, 33926045, 33985854, 34601245, 34625629, 35099506, 35743044, 35843716, 36455873, 36530083, 36979505, 37013586, 37175781, 37770565, 38136952, 38139046, 38176157, 38454193, 38482990, 39198096	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	15935057	Inhibit	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	20392958, 21951954, 24475133, 26708060, 27018938, 27521573, 30014553, 30115946, 31348306, 33325388, 33369083, 33447019, 37948982, 38279143, 38454193	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28937245		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25876647		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21474968, 21966426, 24801982, 28418861, 28597984, 31378884		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22842573, 28418861, 35586989	Associate	★☆☆☆☆ Found in Text Mining only
Common Migraine	Common Migraine	BEFREE	24708359, 28150221		★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	15781040, 21269288, 9073163		★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	8635431, 8821376		★☆☆☆☆ Found in Text Mining only
Compulsive hoarding	Compulsive Hoarding	BEFREE	21668081		★☆☆☆☆ Found in Text Mining only
Conduct Disorder	Conduct Disorder	BEFREE	31264106		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	20846445, 29806700, 30829545, 31255880		★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	22773554		★☆☆☆☆ Found in Text Mining only
Congenital central hypoventilation	Congenital Central Hypoventilation	BEFREE	11840487, 14739359		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Congenital central hypoventilation	Congenital Central Hypoventilation	ORPHANET_DG	11840487		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Congenital central hypoventilation	Congenital Central Hypoventilation	UNIPROT_DG	11840487		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Congenital central hypoventilation	Congenital Central Hypoventilation	GENOMICS_ENGLAND_DG	15657604, 23649659, 30643666		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Congenital central hypoventilation syndrome	Congenital central hypoventilation syndrome	Pubtator	35713175	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	18197083		★☆☆☆☆ Found in Text Mining only
Congenital Hemidysplasia with Ichthyosiform Erythroderma and Limb Defects	Congenital hemidysplasia with ichthyosiform erythroderma and limb defects	Pubtator	23422958, 25422957, 28009101	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	25799225, 27733670, 29601367, 29700574, 30697273, 30909643, 31789613		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27120782		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	19885623, 21554945, 25324022, 28092760, 28131673, 31571628, 31682178		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	11935372		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	19013140, 19013442, 19885623, 21554945, 25324022, 28092760, 28131673, 30424498, 31571628, 31682178		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	21554945, 28760212, 33666096	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	27608901, 31571628, 31682178, 35282820, 35666604, 36401373	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	31571628	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	19885623, 21554945, 25324022, 27608901, 28092760, 28131673, 30674980, 31475168, 31571628, 31682178		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary stenosis	Pubtator	35282820	Associate	★☆☆☆☆ Found in Text Mining only
Cortical cataract	Cortical cataract	BEFREE	29938562		★☆☆☆☆ Found in Text Mining only
Corticobasal degeneration	Corticobasal Degeneration	BEFREE	24112788		★☆☆☆☆ Found in Text Mining only
Corticobasal Degeneration	Corticobasal degeneration	Pubtator	32397876	Associate	★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	33325388	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	19958603, 30940563		★☆☆☆☆ Found in Text Mining only
Cryptogenic Tonic-Clonic Epilepsy	Cryptogenic Tonic-Clonic Epilepsy	CTD_human_DG	16023256		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	27932530, 28982330		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	31071716		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	23314226		★☆☆☆☆ Found in Text Mining only
Deaf Mutism	Deafness	CTD_human_DG	18607918, 19365690		★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	33787399	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deafness, Acquired	Deafness	CTD_human_DG	18607918, 19365690		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	15817657, 19490633, 22178404, 22715356, 31479064		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	BEFREE	26073434, 28317287, 30174226		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Deglutition disorder	Pubtator	32776402	Associate	★☆☆☆☆ Found in Text Mining only
Deletion 11p13	11p deletion syndrome	ORPHANET_DG	23266638		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	27816188, 28280733, 28854532, 29889105		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	39210294	Associate	★☆☆☆☆ Found in Text Mining only
Delusions	Delusions	BEFREE	18596619		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	17151862, 18242855, 19812463, 20172629, 23075484, 24070857, 24275008, 24276217, 25737042, 25784293, 26410307, 27071687, 27545218, 27995575, 28469588, 29067329, 29330839, 29698690, 30018265, 30125821, 30182854, 30220011, 30308512, 30326283, 30469326, 30634650, 30775992, 30802460, 31349032, 31839607		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	LHGDN	17151862		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	23268705, 27995575	Inhibit	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	24276217, 26410307, 31349032, 32996114, 33300824, 33646145, 34601245, 34639513, 38454193	Associate	★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	19953343, 28032515, 28634464, 28944854, 29247598, 29778746, 30550811		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	28567989		★☆☆☆☆ Found in Text Mining only
Depression in children	Mental Depression	BEFREE	16458264, 27073970, 29042908		★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	14708030, 19018715		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depression, Bipolar	Bipolar Disorder	BEFREE	27613282, 28754344, 28761093, 31577039		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depression, Neurotic	Mental Depression	CTD_human_DG	16330021, 21945287		★☆☆☆☆ Found in Text Mining only
Depression, Postpartum	Mental Depression	BEFREE	20169377, 30349488		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	14625141, 14673216, 14699963, 14730194, 15384083, 15666411, 15892658, 15913870, 15918078, 15940299, 16043130, 16300747, 16343697, 16458264, 16606648, 16631126, 16797081, 16890377, 17006024, 17151862, 17222482, 17239400, 17401528, 17409734, 17472225, 17482146, 17579366, 17632285, 17680923, 17700574, 17726474, 17850220, 17911362, 17920693, 17941097, 17959306, 18179845, 18205169, 18208542, 18263664, 18347599, 18450378, 18548532, 18600033, 18602452, 18603005, 18721847, 18752720, 18781861, 18832862, 18842305, 18852698, 18990498, 19111910, 19153574, 19215635, 19236730, 19335934, 19339052, 19423950, 19473709, 19548263, 19589373, 19621014, 19661618, 19846118, 19885623, 19931400, 20014955, 20016225, 20017110, 20034565, 20097294, 20142305, 20163778, 20195291, 20220593, 20226536, 20227453, 20345896, 20346518, 20478625, 20515362, 20515664, 20553751, 20621121, 20653908, 20667416, 20728877, 20921572, 20923424, 21037213, 21056046, 21103954, 21143020, 21188787, 21215389, 21338649, 21420735, 21464126, 21531985, 21577214, 21677379, 21692988, 21880305, 21898033, 21912609, 21996278, 21997575, 22014446, 22033217, 22044630, 22134958, 22210241, 22240101, 22247094, 22265241, 22378223, 22503724, 22610920, 22652301, 22682508, 22844024, 22845879, 22883353, 22931410, 22990943, 23063133, 23157339, 23165919, 23303061, 23399480, 23481907, 23532066, 23570887, 23619509, 23684538, 23704927, 23733090, 23824678, 23880378, 23904143, 23968401, 23992681, 24035489, 24047966, 24070857, 24338983, 24433458, 24586790, 24589356, 24608543, 24655651, 24683520, 24722042, 24745471, 24801253, 24972302, 25277075, 25324022, 25347540, 25510949, 25568448, 25618300, 25648279, 25745134, 25998702, 26000753, 26010085, 26070769, 26118823, 26239616, 26285129, 26313133, 26393465, 26462036, 26556286, 26641254, 26705390, 26706021, 26721949, 26756166, 26795846, 26801497, 26892396, 27062585, 27073970, 27176146, 27261564, 27277475, 27335045, 27378336, 27409526, 27425886, 27501933, 27611068, 27620841, 27634357, 27646262, 27852165, 27861729, 27867101, 27870419, 27900437, 27932530, 27993607, 28092760, 28118829, 28237708, 28237884, 28238069, 28241064, 28284898, 28293733, 28301802, 28302445, 28318471, 28341039, 28342333, 28361262, 28375203, 28387866, 28399791, 28445707, 28483674, 28485899, 28527683, 28527954, 28544903, 28576603, 28578208, 28579944, 28593903, 28600519, 28624596, 28631844, 28645747, 28647666, 28688265, 28694833, 28699511, 28715685, 28744117, 28751018, 28751069, 28752602, 28764913, 28769852, 28783576, 28807619, 28837087, 28905640, 28926000, 28934977, 28990703, 29017372, 29033483, 29042908, 29058041, 29063362, 29075579, 29102768, 29102837, 29126980, 29130652, 29158577, 29194059, 29195162, 29201187, 29235396, 29280414, 29291430, 29310728, 29315742, 29326489, 29331787, 29341893, 29348904, 29438781, 29441975, 29449128, 29501719, 29507199, 29535036, 29550211, 29550391, 29559928, 29626490, 29636708, 29674117, 29680698, 29680784, 29691979, 29717802, 29734099, 29736060, 29748862, 29752492, 29787856, 29802070, 29847468, 29849577, 29849779, 29860945, 29920493, 29930222, 29944703, 29969645, 30003978, 30017710, 30022827, 30076879, 30121663, 30125821, 30149091, 30172225, 30219561, 30235967, 30273985, 30294251, 30296429, 30317434, 30323763, 30329132, 30397531, 30417776, 30449530, 30458370, 30500428, 30503681, 30506371, 30529315, 30586536, 30586639, 30616127, 30616157, 30616482, 30622454, 30636257, 30639279, 30640051, 30658246, 30661441, 30666218, 30699428, 30716615, 30718449, 30734552, 30737641, 30741614, 30767081, 30771710, 30780196, 30829963, 30904785, 30905131, 30929060, 30931847, 30932945, 30978454, 30995790, 31000384, 31022424, 31039391, 31062481, 31076872, 31105542, 31127089, 31195342, 31199848, 31231276, 31234814, 31247244, 31255678, 31265872, 31308724, 31319037, 31327473, 31357443, 31364951, 31379269, 31385340, 31398773, 31416610, 31452446, 31465895, 31474708, 31475168, 31488789, 31513828, 31532659, 31545956, 31568835, 31586041, 31601968, 31602222, 31608449, 31610810, 31611000, 31635145, 31688181, 31735946, 31781286, 31782101, 31807426, 31807545, 31811669, 31815911, 31830487, 31830619		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	CTD_human_DG	16330021, 21945287		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	17632285, 18548532, 19236730, 19931400, 20163778, 20345896, 20346518, 21218562, 22228829, 22844024, 23133609, 23140671, 23303061, 23968401, 24047966, 24103632, 24384148, 24468644, 24801253, 25425456, 25618300, 26118823, 26285129, 26393465, 26641254, 26721949, 26775293, 26967918, 27176146, 28418861, 28590587, 28615544, 28736899, 28744117, 28752602, 28933046, 29595641, 30909076, 30988377, 30994834, 31234814, 32171272, 32397876, 32848137, 33757426, 33779090, 33932264, 33967169, 34613587, 34856753, 35069013, 36473250, 38417853, 40015617	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	LHGDN	18497103		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	22931410, 25277075, 25283187, 25422957, 25510949		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	23704927, 24586790, 27852063, 32612092	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	17632285, 19236730, 19414708, 19931400, 21218562, 22844024, 23968401, 28977521, 29703883, 31889537, 32600964, 33757426, 34325733, 40015617	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	20703451, 24802307, 28509900	Inhibit	★☆☆☆☆ Found in Text Mining only
Depressive Syndrome	Mental Depression	CTD_human_DG	16330021, 21945287		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	27409526		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	15748947, 19038326, 19522715, 21723144, 27409526		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	LHGDN	17161975, 17845420		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatographic urticaria	Dermatographic urticaria	BEFREE	28951710		★☆☆☆☆ Found in Text Mining only
Detrusor and sphincter dyssynergia	Detrusor And Sphincter Dyssynergia	BEFREE	29806700, 31566429		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	30033880		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17151862, 17367556, 18566344, 19270710, 25200302, 26745632, 27062899, 27981512, 28178976, 28341839, 28595187, 29296625, 29740907, 30098276, 30363954, 30550003, 30877409, 31073629, 31786804		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17151862, 17367556, 18566344, 19270710, 25200302, 26706021, 26745632, 27062899, 27981512, 28178976, 28315336, 28341839, 28595187, 28824543, 29296625, 29409455, 29740907, 30098276, 30118750, 30300266, 30363954, 30524286, 30550003, 30729134, 30877409, 31073629, 31786804, 31823816		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	23253673, 28900628, 30550003, 34580389, 35459929, 37072879	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	33029194	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21912638	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23431394, 23968401, 31167208, 33779090	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25587547	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	20615547, 30179684, 31165005		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16784955, 17151862, 17553627, 20215397, 21912638, 23431394, 23968401, 24528214, 26706021, 26739449, 27038292, 27062899, 27553771, 27639791, 27981512, 28315336, 28595187, 28681311, 29062839, 29421245, 29423073, 29425256, 29802953, 29891331, 30039987, 30145601, 30201537, 30308512, 31083054, 31293498, 31453785, 31660832, 31823816		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	12200200, 28178976		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	27355244, 27913110, 28657668, 30300266		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	30670915	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	39412903	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Cerebral Sclerosis of Schilder	Schilder disease	Pubtator	20392958	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	19716854, 22076137		★☆☆☆☆ Found in Text Mining only
Disorder of Sex Development 46 XY	46, xy disorder of sex development	Pubtator	25122490	Associate	★☆☆☆☆ Found in Text Mining only
Disorders of Sex Development	Disorders of sex development	Pubtator	25122490	Associate	★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	33757426, 35328036	Associate	★☆☆☆☆ Found in Text Mining only
Distal Myopathies	Distal myopathy	Pubtator	36228098	Associate	★☆☆☆☆ Found in Text Mining only
Disturbance in mood	Mood Disorder	BEFREE	28744117, 29388082		★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular Diseases	GWASCAT_DG	30177863		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	16815323, 19625522, 20600926, 22669612, 26658127, 29203796, 31605772		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	26393465	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	30833600		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	28549782		★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	18977816, 22766130, 24008922, 24633632, 28757258, 29191473, 30497382, 31778767		★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	LHGDN	18977816		★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	BEFREE	31632253		★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	Pubtator	36550387	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	30542302		★☆☆☆☆ Found in Text Mining only
Dysthymic Disorder	Dysthymic Disorder	BEFREE	15940299		★☆☆☆☆ Found in Text Mining only
Dysthymic Disorder	Dysthymic disorder	Pubtator	28615544	Associate	★☆☆☆☆ Found in Text Mining only
Dystonia	Dystonia	Pubtator	18845611, 19857550	Associate	★☆☆☆☆ Found in Text Mining only
Dystonia Disorders	Dystonia	BEFREE	19857550, 23201631, 23816543, 25523127, 27780732		★☆☆☆☆ Found in Text Mining only
Dystonia, Primary	Dystonia	BEFREE	23201631, 24925604		★☆☆☆☆ Found in Text Mining only
Early onset schizophrenia	Schizophrenia	BEFREE	21917241		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	12888803, 15108194, 15115760, 15657604, 15838534, 15866349, 15913870, 17376155, 18203754, 18855537, 20219210, 20537407, 20573217, 20946355, 21098877, 21290143, 21851847, 21945389, 22473707, 24292283, 24801751, 27483421, 30602138, 31004714, 31746551		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	15748947, 19038326, 19522715, 25649076, 27409526		★☆☆☆☆ Found in Text Mining only
Ehlers-Danlos Syndrome	Ehlers-Danlos Syndrome	BEFREE	30952206		★☆☆☆☆ Found in Text Mining only
Elejalde Disease	Hereditary elliptocytosis	Pubtator	34831151	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	10049950	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	29579552	Stimulate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	29775745, 30863452		★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	CTD_human_DG	16330021, 21945287		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	23936232, 25233929		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	22447624, 22717347, 28277116, 28290209, 28954602, 29141456, 29932639, 30031725, 30608586		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	22717347, 26409150, 28125717, 28277116, 35285386, 37918799	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	37164275	Stimulate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	25945802		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	25945802	Stimulate	★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	25666312, 28963059		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	15138791		★☆☆☆☆ Found in Text Mining only
Epilepsies Partial	Partial epilepsy	Pubtator	36807083	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsies, Partial	Epilepsy	BEFREE	12694935, 30524358		★☆☆☆☆ Found in Text Mining only
Epilepsies, Partial	Epilepsy	LHGDN	12694935		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	10713570, 11124444, 15518235, 16388108, 18208542, 18922788, 19394799, 20188170, 20491871, 20921514, 21890420, 24737869, 25876511, 26000807, 26621122, 26708060, 27787610, 28078614, 28492982, 28527108, 28559979, 29098710, 29358904, 29408225, 29766029, 30210299, 30262417, 30524358, 30738136, 30741614, 30805931, 30909076, 31049031, 31377199, 31400269, 31455240, 8439408		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	CTD_human_DG	15282290		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	Pubtator	20491871, 21390307, 22654603, 26708060, 30015148, 33757426, 38203674, 40634438	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	Pubtator	36807083	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy Generalized	Generalized epilepsy	Pubtator	30735541	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	16818862, 20228460, 29952080, 34102472	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	40634438	Inhibit	★☆☆☆☆ Found in Text Mining only
Epilepsy, Cryptogenic	Epilepsy	CTD_human_DG	15282290		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	10080384, 10713570, 16105728, 19896331, 21986136, 26000807, 26621122, 28527108, 29766029, 30926745		★☆☆☆☆ Found in Text Mining only
Epilepsy, Tonic-Clonic, Familial	Epilepsy	CTD_human_DG	16023256		★☆☆☆☆ Found in Text Mining only
Epilepsy, Tonic-Clonic, Symptomatic	Epilepsy	CTD_human_DG	16023256		★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	15781040, 21269288, 9073163		★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	12032115		★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	31817487		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25962115		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	17376155, 29159909, 31807426		★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	29350074, 30723034		★☆☆☆☆ Found in Text Mining only
Ethylmalonic encephalopathy	Ethylmalonic Encephalopathy	BEFREE	25666312, 28963059		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	27145455		★☆☆☆☆ Found in Text Mining only
Extrapyramidal Disorders	Extrapyramidal disease	BEFREE	18408624		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	17344400		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	10632606		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	17652166, 30585393		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	15279867		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	LHGDN	15279867		★☆☆☆☆ Found in Text Mining only
Feeding and Eating Disorders	Eating Disorders	LHGDN	15108194, 17217930		★☆☆☆☆ Found in Text Mining only
Female sexual dysfunction	Female sexual dysfunction	BEFREE	27787964		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	19072833		★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia	Focal cortical dysplasia	BEFREE	28737124		★☆☆☆☆ Found in Text Mining only
Focal Dystonia	Focal dystonia	BEFREE	30519954		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	15893122, 19394799, 21890420, 23727436, 26709905		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	32397876	Associate	★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	22596272, 29867188		★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	28481834		★☆☆☆☆ Found in Text Mining only
Functional Gastrointestinal Disorders	Functional Gastrointestinal Disorders	BEFREE	23020799		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	28423707		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	20353905	Associate	★☆☆☆☆ Found in Text Mining only
Ganglioneuroblastoma	Ganglioneuroblastoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	29459716, 31339548	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	34804639	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	36430458	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease, Type 1	Gaucher Disease	BEFREE	27865783		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	15781040, 21269288, 9073163		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	BEFREE	29766029		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	25418464	Associate	★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	16541456, 25771937, 27900437, 31243645		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	19422885, 26560713, 28068360, 29676228, 29896439, 30258047		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma	Glaucoma	Pubtator	32985274	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma	Glaucoma	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma Open Angle	Open angle glaucoma	Pubtator	25893192	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	BEFREE	30897622		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	23484957, 25893192, 29120253, 29417213, 30400122		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21152857, 26119933, 29182611, 30746749		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10728904, 21152857, 26119933, 29182611, 30746749		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17696644, 18175076, 18937073, 25538243, 26119933, 28640008, 29257320, 29383986, 29540297, 29633591, 30092219, 9815748		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23576602, 34953024, 37100464	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	19238500, 29160031, 31235756		★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	27849045		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	30871541		★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	8635431, 8821376		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	37175781	Associate	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	30134862	Associate	★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	26687809, 29938562		★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	29451335		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	28544903		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	29312563		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	21509595, 21951954, 36807083	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	25799225, 27733670, 29601367, 29700574, 30697273, 30909643, 31789613		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	32703621, 35501813, 36074967	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemimegalencephaly	Hemimegalencephaly	BEFREE	15002051		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	22773554	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	36430458	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	28506823, 29518527		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	23519890, 29992511		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	23519890	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	16081212		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	11840487, 14566559		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	29727764, 31379269		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	11408619, 14713958, 14999077, 16006135, 16288298, 16487146, 16847693, 16905325, 17096834, 17151278, 17959817, 18093249, 18571429, 18602275, 18632688, 18640989, 19193881, 19228174, 19733666, 19745829, 19996106, 20007471, 20736066, 21048129, 21681558, 21713039, 21857974, 22179316, 22393909, 23145961, 23598407, 23977241, 24105466, 24248060, 24285878, 25155142, 25180603, 26307259, 26604684, 27236019, 27466197, 27587303, 27601642, 27823570, 28361262, 28541476, 28694434, 28823953, 28939435, 29209158, 29388082, 29727764, 29769266, 29804232, 29856034, 29860423, 29891550, 29932126, 30022873, 30451892, 31286142, 31379269, 31392756, 31614758, 31665619		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington Disease	LHGDN	16604191, 17427191		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington disease	Pubtator	18093249, 19228174, 22748967, 33378838, 33568689, 33631722, 34296279, 37287291	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington disease	Pubtator	18093249, 21857974, 33065279	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hydatidiform Mole	Hydatidiform Mole	BEFREE	22719055		★☆☆☆☆ Found in Text Mining only
HYDATIDIFORM MOLE, RECURRENT, 1	Hydatidiform Mole	BEFREE	22719055		★☆☆☆☆ Found in Text Mining only
Hydranencephaly	Hydranencephaly	Pubtator	21228168	Associate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	27535166		★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	29247156		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	27913110, 28254195, 29930382, 30365051, 30877409, 31141256, 31165005		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	29296625		★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	17130481, 32493978	Associate	★☆☆☆☆ Found in Text Mining only
Hypersomnia	Hypersomnia	BEFREE	22379239		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19210038	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	26192455	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	19210038, 23058367, 27364224, 28005701, 30301188, 30767081, 30894041		★☆☆☆☆ Found in Text Mining only
HYPERTRICHOSIS, CONGENITAL GENERALIZED	HYPERTRICHOSIS	BEFREE	21227937		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	28235781		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	28343294, 30179684		★☆☆☆☆ Found in Text Mining only
Hypothalamic hamartomas	Hypothalamic Hamartomas	BEFREE	25307426		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	29290043, 30119135		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	32597152	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	34879183, 35843716	Associate	★☆☆☆☆ Found in Text Mining only
Hypotrichosis simplex	Hypotrichosis simplex	BEFREE	26872063		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18486103	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	24462831, 26192455	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	26842559, 30046375	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	28343294		★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Ichthyosis Bullosa Of Siemens	BEFREE	25998025, 26837784		★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Junctional epidermolysis bullosa	Pubtator	30622656	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28938915		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	28938915	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	23058367		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	21178826		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	29494605		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	34831151	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	27380932		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	16314887, 16603474, 16606648, 16627933, 16818862, 17130481, 18203167, 19412541, 19538209, 20447730, 20491609, 21366724, 21840749, 21898045, 21951954, 22265241, 22362486, 22396415, 22473707, 23082852, 23517654, 23769397, 24074845, 24086677, 24112788, 24275008, 24289461, 24292283, 24394906, 24465375, 24660789, 24862657, 25153701, 25288138, 25443284, 26000753, 26280836, 26289590, 26496261, 26603624, 26708060, 26745632, 26806863, 26819457, 27221213, 27288826, 27329329, 27486045, 27558235, 27561148, 27979325, 28017130, 28065587, 28099630, 28119229, 28132883, 28158153, 28164772, 28315336, 28341039, 28342945, 28352664, 28377712, 28380447, 28402427, 28403087, 28469588, 28477447, 28492982, 28506823, 28520803, 28668331, 28681311, 28711394, 28769792, 28824418, 28840059, 28940173, 28947280, 28951142, 28956815, 28969308, 28979677, 28993643, 29090669, 29111458, 29114922, 29130652, 29195162, 29258453, 29277879, 29306772, 29352445, 29402782, 29421245, 29423073, 29425256, 29476728, 29482040, 29518527, 29520217, 29574629, 29604364, 29715537, 29723552, 29847220, 29867443, 29896133, 29952080, 29971668, 29986171, 30013647, 30018265, 30031883, 30064014, 30076879, 30086367, 30182854, 30233298, 30277635, 30308512, 30315904, 30323150, 30326283, 30333719, 30341248, 30344474, 30346599, 30358144, 30359966, 30374679, 30374909, 30374941, 30382534, 30463591, 30469326, 30524286, 30612279, 30621666, 30659208, 30659644, 30661230, 30687079, 30695686, 30710808, 30717153, 30746828, 30775992, 30808582, 30828070, 30835822, 30867119, 30875947, 30877026, 30880220, 30899092, 30909233, 31036753, 31040784, 31041658, 31083054, 31104169, 31199848, 31202861, 31279826, 31284882, 31352261, 31365694, 31374192, 31385821, 31396062, 31420036, 31550727, 31617564, 31623364, 31708739, 31737188, 31771052, 31812581, 31841155, 31841660		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	HPO_DG			★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	28277116, 34054723	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29321655, 29543647		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	23253673, 29369497	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	25587547	Stimulate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	CTD_human_DG	11357950		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual Disability	Mental retardation	BEFREE	18753648, 19096215, 20943059, 28397838, 29203796, 29532458, 30033880, 30231518, 7896291, 8717056		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual Disability	Intellectual developmental disorder	Pubtator	18753648, 38482990	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual Disability	Mental retardation	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	18727839, 33652921, 36642939	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	29215065		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	30143695	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Obstruction	Intestinal Obstruction	BEFREE	29781158, 30259610		★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	22773554	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	30268558		★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	BEFREE	29234149		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	30117045		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	25998025, 26837784, 29543647, 30670915, 30800058, 31272268, 31413530		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	30670915	Stimulate	★☆☆☆☆ Found in Text Mining only
Ischemic Attack Transient	Transient ischemic attack	Pubtator	33076256	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	20417695, 22633192, 23648611, 24035862, 24722042, 25241287, 25470006, 27077983, 27815836, 28181779, 28982330, 29449128, 29682700, 29997237, 30416389, 30486515, 30522804, 30618628, 30826210, 30964066, 31141256, 31220552, 31819463		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	32576868	Associate	★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	15781040, 21269288, 9073163		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	23489213		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28377318, 29540150		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	31055001		★☆☆☆☆ Found in Text Mining only
Kleefstra Syndrome	Kleefstra syndrome	Pubtator	39343771	Associate	★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	29249935		★☆☆☆☆ Found in Text Mining only
Language Disorders	Language Disorders	BEFREE	31756156		★☆☆☆☆ Found in Text Mining only
Language Disorders	Language development disorders	Pubtator	31756156	Associate	★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning disorders	Pubtator	32493978, 36550387	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	28225023		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	22911740	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19059881	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	25241901		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	31498938		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	16899999, 19276553, 19812463		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21421859, 22583359, 26581909, 30508943, 30659644, 31257521		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	27062585		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	31557760		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	28459374	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	LHGDN	18069415		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26926340, 27456333, 34209215	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	16606648	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	24223945	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36506019	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16606648, 21678493, 28237708, 30376438, 31255912		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	31255912		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28459374	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	28771226		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29989647, 36151890	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	19716854	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	19716854		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	35370941	Stimulate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	36361771	Associate	★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	14735135, 15274036, 15543516, 16005437, 17143075, 25106037		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	14735135, 15274036, 15543516, 16005437, 17143075, 25106037		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	14735135, 15274036, 15543516, 16005437, 17143075, 25106037		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	14735135, 15274036, 15543516, 16005437, 17143075, 25106037		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	14735135, 15274036, 15543516, 17143075, 25106037		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	14735135, 15274036, 15543516, 17143075, 25106037		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	14735135, 15274036, 15543516, 17143075, 25106037		★☆☆☆☆ Found in Text Mining only
Major depression, single episode	Mental Depression	BEFREE	28848102, 29332095, 29802070, 30526722		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	LHGDN	12842310		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	14582140, 15913870, 16005437, 16300747, 16343697, 16979146, 17036259, 17401528, 17404118, 17510948, 17632285, 18081157, 18179845, 18329817, 18657242, 18721847, 18752720, 18781861, 18852698, 18923405, 19236730, 19376528, 19414708, 19493959, 19589373, 19668114, 19699537, 19931400, 20016225, 20033742, 20124106, 20167454, 20195291, 20207421, 20230085, 20653908, 20674983, 20682308, 20703451, 20921514, 21129438, 21188787, 21218562, 21338649, 21510922, 21692988, 21889574, 21912391, 21912609, 21938001, 22033217, 22194899, 22247094, 22378223, 22504456, 22585743, 22681170, 22844024, 22883353, 22965830, 23128924, 23137999, 23157339, 23165919, 23184535, 23250003, 23255668, 23341118, 23570887, 23570888, 23603442, 23619509, 23733090, 23968401, 24093582, 24213247, 24577123, 24683520, 24927694, 24972302, 25012449, 25044977, 25106037, 25387785, 25451398, 25510949, 25568448, 25745134, 25796564, 25990886, 26010085, 26078197, 26117067, 26239616, 26462036, 26556688, 26717541, 26746105, 26876488, 26921055, 26935651, 27018938, 27212180, 27246986, 27261564, 27277475, 27603714, 27613282, 27787964, 28011898, 28241064, 28301802, 28334675, 28375203, 28387866, 28509900, 28550365, 28656803, 28688265, 28761093, 28831019, 28833192, 28837087, 28848102, 28928987, 28942954, 28977521, 29058041, 29102768, 29243873, 29310728, 29334322, 29387021, 29414128, 29432620, 29450725, 29460712, 29476595, 29541037, 29703883, 29725086, 29752492, 29778546, 29898192, 29930221, 29945425, 30028316, 30125821, 30153634, 30219561, 30269040, 30273985, 30449530, 30459647, 30548775, 30583245, 30640051, 30677092, 30753865, 30794585, 30905131, 30929060, 30929061, 30986693, 31000384, 31027379, 31076872, 31105542, 31142907, 31188139, 31231276, 31295515, 31308724, 31379496, 31449911, 31465895, 31480771, 31532659, 31601403, 31636250, 31654971, 31711978, 31721892, 31792367		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	22801293, 24577123, 25044977, 25510949, 25658497		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	29504577		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	23576602, 31219215, 8450561		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	29312563		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18199526, 21350004, 22210241, 22895657, 25036590, 26657794, 26967918, 27813254, 28230291, 28446206, 28554249, 28800782, 29512753, 30382534, 30550003, 31105428, 31642812		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	25233929		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	28423707, 29599313		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	29459716, 30741921		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	29312563		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16862449, 23312550, 24560686, 24982195, 26926340, 27456333		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	16935322, 19307055		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23142633		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10353759, 10637439, 11911243, 12213679, 21097678, 27456333, 31422041		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29715534, 31172586		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	21142662, 29037860, 30146756, 31210313		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29322793, 29402794, 30387205		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11027413, 16173964, 17635673, 19386345, 19716854, 21128244, 21474968, 21670725, 22906736, 23285024, 23624487, 24222250, 24801982, 24913346, 25030435, 25233929, 25876647, 25962115, 26614346, 26926340, 27469492, 28459374, 28604807, 28650560, 28668500, 28739680, 28884193, 28903357, 29122484, 29285171, 29322793, 29402794, 29504577, 29618742, 29661830, 29989647, 30796353, 30961497, 31297057, 31485624, 31704818, 31777532		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28405685, 29572178, 29989647		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25876647		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	30200858		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	14708030, 19018715		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	17239400, 17680923, 20483468, 22484201, 26621529, 27138695, 27267245, 28700015, 31574363		★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	14708030, 19018715		★☆☆☆☆ Found in Text Mining only
Maple Syrup Urine Disease	Maple Syrup Urine Disease	BEFREE	27660262, 31235756		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	23869086		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	10200298		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	17550129, 19642024, 26614346, 29344238, 7809137		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	CTD_human_DG	16330021, 21945287		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	BEFREE	19236730, 22247094, 22965830, 23165919, 26462036		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21418516, 23142633, 27344179, 27901477, 29215016, 29358574, 31071716, 31325530, 8305739, 8908597		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27344179, 27510459	Associate	★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	16818862, 20662942, 25288138, 26410307, 26496261, 27521573, 28099630, 28720165, 28755387, 28933046, 32493978, 32985495, 33325388, 33926045, 34997117, 35099506, 36977737	Associate	★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	25180603, 30086367, 31608530		★☆☆☆☆ Found in Text Mining only
Mental deficiency	Mental retardation	CTD_human_DG	11357950		★☆☆☆☆ Found in Text Mining only
Mental deficiency	Mental retardation	BEFREE	20175892		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	14625141, 14673216, 14699963, 14730194, 15384083, 15666411, 15892658, 15913870, 15918078, 15940299, 16300747, 16343697, 16458264, 16606648, 16631126, 16797081, 16890377, 17006024, 17151862, 17222482, 17239400, 17401528, 17409734, 17472225, 17482146, 17632285, 17680923, 17700574, 17726474, 17850220, 17911362, 17920693, 17941097, 17959306, 18179845, 18205169, 18208542, 18263664, 18347599, 18450378, 18548532, 18600033, 18602452, 18603005, 18721847, 18752720, 18781861, 18832862, 18842305, 18852698, 18990498, 19111910, 19153574, 19215635, 19236730, 19335934, 19339052, 19423950, 19473709, 19548263, 19589373, 19621014, 19661618, 19846118, 19885623, 19931400, 20014955, 20016225, 20017110, 20034565, 20097294, 20142305, 20195291, 20220593, 20226536, 20227453, 20345896, 20346518, 20478625, 20515362, 20515664, 20553751, 20621121, 20653908, 20667416, 20728877, 20921572, 20923424, 21037213, 21056046, 21103954, 21143020, 21188787, 21215389, 21338649, 21420735, 21464126, 21531985, 21577214, 21677379, 21692988, 21880305, 21898033, 21912609, 21997575, 22014446, 22033217, 22044630, 22134958, 22210241, 22240101, 22247094, 22378223, 22503724, 22610920, 22652301, 22682508, 22844024, 22845879, 22883353, 22931410, 22990943, 23063133, 23157339, 23165919, 23303061, 23399480, 23481907, 23532066, 23570887, 23619509, 23684538, 23704927, 23733090, 23824678, 23880378, 23904143, 23968401, 23992681, 24035489, 24047966, 24070857, 24338983, 24433458, 24586790, 24589356, 24608543, 24655651, 24683520, 24722042, 24745471, 24801253, 24972302, 25277075, 25324022, 25347540, 25510949, 25568448, 25618300, 25648279, 25745134, 25998702, 26000753, 26010085, 26070769, 26118823, 26239616, 26285129, 26313133, 26393465, 26462036, 26556286, 26641254, 26705390, 26706021, 26721949, 26756166, 26795846, 26801497, 26892396, 27062585, 27073970, 27176146, 27261564, 27277475, 27335045, 27378336, 27409526, 27425886, 27501933, 27611068, 27620841, 27634357, 27646262, 27852165, 27861729, 27867101, 27870419, 27900437, 27932530, 27993607, 28092760, 28118829, 28237708, 28237884, 28238069, 28241064, 28284898, 28293733, 28301802, 28302445, 28318471, 28341039, 28342333, 28361262, 28375203, 28387866, 28399791, 28445707, 28483674, 28485899, 28527683, 28527954, 28544903, 28576603, 28578208, 28579944, 28593903, 28600519, 28624596, 28631844, 28645747, 28647666, 28694833, 28699511, 28715685, 28744117, 28751018, 28751069, 28752602, 28764913, 28769852, 28783576, 28807619, 28837087, 28905640, 28926000, 28934977, 28990703, 29017372, 29033483, 29042908, 29058041, 29063362, 29075579, 29102768, 29102837, 29126980, 29130652, 29158577, 29194059, 29195162, 29201187, 29235396, 29280414, 29291430, 29310728, 29315742, 29321655, 29326489, 29331787, 29341893, 29348904, 29438781, 29441975, 29449128, 29501719, 29507199, 29535036, 29550211, 29550391, 29559928, 29626490, 29636708, 29674117, 29680698, 29680784, 29691979, 29717802, 29734099, 29736060, 29748862, 29752492, 29787856, 29802070, 29847468, 29849577, 29849779, 29860945, 29920493, 29944703, 29969645, 30003978, 30017710, 30022827, 30076879, 30121663, 30125821, 30149091, 30172225, 30219561, 30235967, 30273985, 30294251, 30296429, 30317434, 30323763, 30329132, 30397531, 30417776, 30449530, 30458370, 30500428, 30503681, 30506371, 30529315, 30586536, 30586639, 30616127, 30616157, 30616482, 30622454, 30636257, 30639279, 30640051, 30658246, 30661441, 30666218, 30699428, 30716615, 30718449, 30734552, 30737641, 30741614, 30767081, 30771710, 30780196, 30829963, 30904785, 30905131, 30929060, 30931847, 30932945, 30978454, 30995790, 31000384, 31022424, 31039391, 31062481, 31076872, 31105542, 31127089, 31195342, 31231276, 31234814, 31247244, 31255678, 31265872, 31308724, 31319037, 31327473, 31357443, 31364951, 31379269, 31385340, 31398773, 31452446, 31465895, 31474708, 31475168, 31488789, 31513828, 31532659, 31545956, 31568835, 31586041, 31601968, 31602222, 31608449, 31610810, 31611000, 31635145, 31688181, 31735946, 31782101, 31807426, 31807545, 31811669, 31815911, 31830487, 31830619		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	22931410, 25277075, 25283187, 25422957, 25510949		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	12836135, 15537879, 15770238, 16005437, 17217930, 17375136, 17632285, 17894414, 18205169, 18329817, 18548532, 18797396, 19111910, 19336781, 19376528, 19414708, 19424874, 19603419, 19896331, 19931559, 20042999, 20085561, 20712016, 20921514, 20957650, 21126736, 21167606, 21358740, 21464126, 21601610, 21791566, 21894152, 21898045, 21924328, 21986359, 22281237, 22548711, 22669612, 23065263, 23327756, 23593198, 23739121, 23973796, 24051499, 24484701, 24683520, 24708359, 24795156, 24801253, 24870235, 25223903, 25264289, 25335167, 25354496, 25364831, 25450314, 25796564, 25824305, 26115627, 26118823, 26209750, 26215504, 26503495, 26830347, 27105834, 27267954, 27874848, 27908981, 28009101, 28134845, 28215308, 28342945, 28508317, 28509900, 28593903, 28620285, 28710695, 28761093, 28872625, 28937692, 28942954, 28977521, 29050222, 29235396, 29582716, 29649711, 29953671, 30329132, 30341412, 30347311, 30397000, 30463271, 30472511, 30513310, 30615977, 30806160, 30880220, 30986693, 30998730, 31195344, 31440144, 31617281, 31711978, 31779002		★☆☆☆☆ Found in Text Mining only
Mental Disorders, Severe	Mental Disorders	BEFREE	30126813, 30560709		★☆☆☆☆ Found in Text Mining only
Mental impairment	Mental Depression	BEFREE	15337270		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	18753648, 19096215, 7896291, 8717056		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma Malignant	Mesothelioma	Pubtator	30309369	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	27132650		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	23890480, 23967328, 31502573	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	20163778, 23890480, 23967328, 24269186, 26706021, 28361262, 28477447, 28562580, 29346609, 29938316, 30456540, 31502573, 31700717		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	LHGDN	17611164, 18478177		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	17611164	Associate	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	18478177, 20959432, 24708359, 26966318, 27875242, 28150221, 28507530		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	20556464, 22584531	Stimulate	★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	BEFREE	24708359, 29722303		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	17908035, 18505307, 19412541, 20491609, 22699449, 24253237, 25024337, 25062900, 25532446, 26138246, 26292618, 26923413, 27113997, 27545218, 27815832, 27935556, 27995575, 28341039, 28387675, 28833437, 28888073, 28946752, 29353543, 29572131, 29775745, 30308512, 30634650, 30717153, 30775992, 30886577, 31348306, 31453785, 31518516, 31562049, 31771052		★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	BEFREE	15118353		★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	20951500		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	18797396, 27932530, 28092086, 28445707, 29595641, 29603029, 31764606, 31782101		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	12091467, 12161822, 16649215, 18704093, 18787660, 19018231, 19236730, 19336781, 19931400, 21223646, 21612826, 24398043, 24802307, 24944871, 27695066, 28744117, 28752602, 30711709	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	BEFREE	12161822, 14609502, 14673216, 14681916, 14735135, 15384083, 15626819, 15635706, 15770238, 15940299, 16649215, 16741941, 16787706, 17239400, 17392738, 17505499, 17510948, 17726474, 17882234, 17920693, 18347002, 18450378, 18543122, 18664999, 18704093, 18781861, 19018231, 19018714, 19236730, 19335934, 19336781, 19376528, 19473771, 19530966, 19589503, 19931400, 20034565, 20483468, 20515664, 20653908, 20726824, 21223646, 22225729, 22265241, 22378223, 22609366, 23399480, 23684538, 23739121, 23823988, 24069289, 24112874, 24398043, 24944871, 24972302, 25012449, 25106037, 25383981, 26091093, 26621529, 27425886, 27697135, 27699937, 27956743, 28078988, 28144920, 28257759, 28387866, 28427565, 28485899, 28706476, 28752602, 28926000, 30072053, 30078664, 30347685, 30394136, 30572337, 30637517, 30666218, 30711709, 30929061, 30995444, 31118969, 31231295, 31416610		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	LHGDN	16472361, 19018714		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	24369067, 24944871, 24972302, 25106037, 25383981		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood swings	Mood swings	BEFREE	28092086, 29803101		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	12645079, 9851658		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor neuron disease	Pubtator	37569576	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	28418939, 32776402	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	35925599	Associate	★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement disorder	Pubtator	22615781	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	20331634, 22895657, 23420490		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	36565997	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10049950, 12390966, 12753507, 14568126, 15710474, 16046000, 16356643, 16740142, 17602759, 17656372, 17898009, 18061279, 18329726, 18992902, 19874854, 20541775, 20558237, 20656764, 20951500, 20953813, 22341604, 22393127, 22921736, 23593393, 25579386, 26439969, 26756166, 27979325, 28363412, 28392137, 29085589, 29108879, 29530550, 29865854, 30352103, 30644699, 30734989, 30965275, 31713782, 31741027		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	10049950, 16740142, 20656764, 23593393, 30352103, 30644699, 35205376, 38003363, 38136952	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	12753507, 23101271	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	16046000, 18061279		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	36754216	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	12753507, 16740142, 19071096, 20541775, 27587303, 29643001		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	LHGDN	19071096		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	28045063		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	28045063	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	30577408		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	30577408		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	25892961, 28070911, 30121216, 30226568, 30359966, 30697273		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	28760212	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	31574344		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	34160912	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11205744, 11355310, 11911243, 15138791, 15880586, 15944784, 16618748, 16778834, 17080715, 18199526, 19173004, 19755385, 19916560, 20331634, 21097678, 21421859, 21474968, 21670725, 21831423, 21966426, 22076137, 23420490, 23576602, 24064679, 24327398, 24710624, 24801982, 25036590, 25331179, 26581909, 27145455, 27498977, 27926508, 28282971, 28292827, 28418861, 28420987, 28459374, 28604807, 28739680, 28771226, 28791400, 28819854, 28860499, 28901408, 29572178, 29661830, 29748024, 29861866, 29901097, 30309369, 30581482, 30641914, 30675270, 30796353, 30961497, 31075511, 31172586, 31308194, 8706017, 8795581, 9049830, 9580079		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	11157019, 18753648, 23266638, 8717056		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	24943717, 34879183	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
nervous system disorder	Nervous System Disorder	BEFREE	20818776, 22281237, 22720171, 23253771, 23712629, 24475283, 25223903, 26000807, 27771971, 28243312, 28272318, 28341039, 28377318, 28466111, 28492549, 28751857, 29057125, 29217485, 29274773, 29298820, 29305263, 29540150, 30221704, 30753865, 30841499, 31279955, 31532010, 31751881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
nervous system disorder	Nervous System Disorder	CTD_human_DG	22240983		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	BEFREE	10022810, 10336437, 10501184, 10728907, 10803465, 11205744, 11912158, 11927634, 12438236, 12700894, 12808116, 14654552, 14699967, 15015775, 15207915, 15637590, 15781614, 15784962, 16051641, 16215672, 16487497, 16618748, 16778834, 17194538, 17344400, 17374610, 18601743, 18678285, 19050044, 19142969, 19363525, 19386345, 19734938, 20331634, 20600926, 21728718, 21731748, 21988661, 21990266, 24253178, 24403123, 24488767, 25026432, 25132261, 25700942, 28245069, 28265338, 28377712, 28921568, 29063362, 29305654, 29378496, 29959561, 30301369, 30712809, 30806012, 31271959, 31308194, 31787850, 8394722, 8397102, 8441429, 8552397, 8706017, 8795581, 9049830, 9049831, 9136990, 9516852, 9580079, 9822157		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10347207, 10501184, 12808116, 21419569, 21590687, 21731748, 21990266, 27456333, 29959561, 32389647, 39389992, 8264643	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	38493476	Stimulate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	11161609, 20345896, 22989210, 23519890, 23785422, 23924085, 24086677, 25893192, 26289590, 28720165, 28755387, 30448615, 32539856, 33833366, 35205376, 36170028, 37085692, 37543811	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	35008438, 37287291	Inhibit	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	11244490, 11553687, 12391585, 12722826, 15518235, 17151278, 19498435, 19621014, 20345896, 21044653, 21857974, 22548386, 22989210, 23404502, 23519890, 23674053, 23924085, 23934644, 27000219, 27209362, 27701410, 27813712, 27815842, 27908981, 27975267, 28011163, 28153028, 28215299, 28261618, 28273832, 28315978, 28361262, 28438600, 28501999, 28825842, 29247376, 29427085, 29510124, 29526852, 29604364, 29896439, 29982985, 29987039, 30067287, 30117045, 30117106, 30135302, 30326283, 30341696, 30387183, 30428894, 30448615, 30574426, 30593410, 30871541, 30929164, 30961497, 31078687, 31134487, 31156376, 31574357, 31734438, 31751881		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	16996699, 25147297, 27288826, 28751857, 31264106, 31404529		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	10549931		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	23312550, 8897438		★☆☆☆☆ Found in Text Mining only
Neurogenic Urinary Bladder	Neurogenic Urinary Bladder	BEFREE	20846445		★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	10202982		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	31803011		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	20553714, 30090490, 30179684, 31052296		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	15384083, 15918078, 16043130, 17392738, 17920693, 18548532, 18797396, 18957941, 19153574, 20042999, 20345896, 23333821, 26738427, 30022827		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C1	Sphingomyelinase deficiency	BEFREE	19851340		★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	8635431, 8821376		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20214505, 22906736, 27456333, 27498977, 28459374, 29748024, 31421833, 31695428		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	16389585, 17417060, 18319075, 18718885, 19142409, 19462300, 20102668, 20736000, 21044653, 21248641, 22192502, 22213405, 23327756, 23429848, 23748016, 25246365, 26215504, 26603624, 27629407, 28142064, 28472632, 28550022, 28599751, 29584866, 29785763, 29938562, 30629965, 31445421, 31688384, 31822818		★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10716929, 15457498, 15657604, 16784955, 17130481, 17151862, 17553627, 17652166, 18667348, 18753648, 19270710, 19622243, 19851340, 20537407, 20663924, 21527513, 21567907, 21708048, 21796137, 21851847, 21912638, 21945389, 22426422, 22687148, 23266638, 23325614, 23424664, 23431394, 23624487, 23628854, 23640704, 23643991, 23890480, 23967328, 24081231, 24528214, 24619555, 24708359, 25874530, 26162542, 26526993, 26680480, 26706021, 27108933, 27132650, 27166632, 27288826, 27551991, 27608901, 27981512, 28238069, 28281382, 28396685, 28462726, 28471701, 28595187, 28677406, 28717164, 28818748, 28960774, 29061165, 29130652, 29160031, 29217485, 29296625, 29326489, 29339649, 29506764, 29726700, 29914985, 29920493, 29981843, 30039987, 30081509, 30253111, 30308512, 30363954, 30456540, 30512217, 30585393, 30590963, 30794116, 31004714, 31384856, 31502573, 31665880, 31837640		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Obesity	Obesity	Pubtator	17130481, 18753648, 19692490, 20520848, 20712903, 20843981, 21668081, 21708048, 21779088, 21851847, 22513296, 23326649, 23349760, 23408508, 23628854, 23820787, 23950976, 23967328, 24059907, 24626232, 25122490, 25484485, 25520250, 26449484, 26526993, 26680480, 27421018, 27608901, 29061165, 30590963, 30926952, 31167208, 32493978, 33801339, 33859285, 33862146, 34525971, 34836030, 36839421, 36921152, 37085692, 37329217, 37865417, 39743445	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Obesity	Obesity	GWASCAT_DG	23563607		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Obesity	Obesity	GWASDB_DG	23563607		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Obesity	Obesity	Pubtator	27551991, 28012455, 28677406	Inhibit	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Obesity	Obesity	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Obesity Abdominal	Obesity	Pubtator	23424664, 23890480, 31502573, 34525971	Associate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	CTD_human_DG	21708048		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity, Morbid	Obesity	BEFREE	30274741, 30718415, 31004714		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	12836135, 16541456, 17241828, 17375136, 17853300, 17884018, 18197083, 19219856, 19589503, 21616543, 21668081, 22153732, 22176623, 22521161, 22911909, 23999029, 24050777, 24291483, 25710846, 25771937, 26209750, 26503495, 29079096, 29302747, 31004918, 31046037, 31180700, 31291217		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	LHGDN	12836135, 16541456		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ocular Hypertension	Ocular Hypertension	BEFREE	19422885, 26560713		★☆☆☆☆ Found in Text Mining only
Ondine syndrome	Ondine Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Oppositional Defiant Disorder	Oppositional Defiant Disorder	BEFREE	24229538		★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	31803011		★☆☆☆☆ Found in Text Mining only
OROFACIAL CLEFT 1	Orofacial Cleft	BEFREE	22123938		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	22715356	Associate	★☆☆☆☆ Found in Text Mining only
Osteochondritis Dissecans	Osteochondritis Dissecans	BEFREE	21616543, 26209750		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	29636865		★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	27458153	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	28903900, 34516503	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30791080		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24067459, 30352834, 31002124, 34717683	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	31002124		★☆☆☆☆ Found in Text Mining only
OTOFACIOCERVICAL SYNDROME 1	Otofaciocervical Syndrome	BEFREE	22123938		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	35300713	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	19508998, 28277119		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16935322, 19307055		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28984201, 31298409	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23142633		★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	29108028		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	14613990		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34777634	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	15118353, 15913870, 19461660, 24484701, 24508446, 26037856, 26687639, 27355213, 28761093, 30269521, 30742590, 31465895		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	33047489, 33757426	Associate	★☆☆☆☆ Found in Text Mining only
Paranoia	Paranoia	BEFREE	18721261		★☆☆☆☆ Found in Text Mining only
Paranoid Disorders	Paranoia	Pubtator	18721261	Associate	★☆☆☆☆ Found in Text Mining only
Paranoid Schizophrenia	Paranoid Schizophrenia	BEFREE	21710362, 23487199, 24069289, 28761093		★☆☆☆☆ Found in Text Mining only
Paresis	Paresis	Pubtator	27007747	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	11031089, 11782995, 14623353, 14642442, 15120095, 15666411, 15717064, 15838855, 16172806, 16565926, 16899999, 17229524, 17427185, 18923405, 18977816, 19276553, 19498435, 19538209, 20085561, 20542127, 21167764, 21510922, 21858606, 21924942, 22001244, 23555734, 23611539, 23934644, 24008922, 24051673, 24329127, 24374887, 24394906, 24475283, 24633632, 25120226, 25431370, 25444596, 26806863, 27237108, 27852165, 27915043, 28097465, 28338380, 28346830, 28361262, 28396009, 28432010, 28461162, 28507529, 28539884, 28576603, 28634349, 28713483, 28923922, 29030221, 29191473, 29247376, 29249680, 29350074, 29419747, 29558315, 29568518, 29698690, 29781786, 29896439, 30017781, 30031602, 30152864, 30296429, 30627374, 30690135, 30723034, 30815845, 30961497, 30993592, 31104169, 31125623, 31134487, 31185338, 31195342, 31197095, 31202861, 31220543, 31292011, 31301412, 31365694, 31539561, 31555122, 31606860, 31644786, 31718583, 31820346, 8590062		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	12882651, 16565926, 23924085, 26253177, 26497684, 26806863, 29191473, 29547479, 32022467, 33215284, 34288271, 37287291, 38417853, 39392027, 40015617	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	LHGDN	15120095, 15772739, 16344533, 17427185, 18977816		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	19276553		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	27220776	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	36768317	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	24394906, 29030221, 29512462, 30296429		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	23609402, 28432010, 8590062		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian Disorders	Parkinson disease	Pubtator	39412903	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paroxysmal ventricular fibrillation	Paroxysmal ventricular fibrillation	Pubtator	34054723	Associate	★☆☆☆☆ Found in Text Mining only
Partial Trisomy	Trisomy	BEFREE	22669612		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	18753648, 21851847, 23325614		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	25587209		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	25587209	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	36997422	Inhibit	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	17367556, 30550003, 31353867, 9572670		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	28900628, 30550003, 35682716, 37426324, 37522679	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	17367556, 30235967, 30550003, 31353867		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	23175149, 35280682	Associate	★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	19582565, 23517654, 25535174, 27506602, 28360521, 28500650, 29073621		★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	8635431, 8821376		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	30656694		★☆☆☆☆ Found in Text Mining only
Phobic anxiety disorder	Phobic Anxiety Disorder	BEFREE	21295349, 24768157		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	19812463, 24112788		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	12032115, 29095861		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	22507324	Associate	★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	20214505, 30309369		★☆☆☆☆ Found in Text Mining only
Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy	Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy	Pubtator	21228168	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30608586		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	16649215, 20955337, 21491204, 21727254, 21728904, 21931317, 23103549, 23312562, 24035489, 24484701, 25925851, 25985955, 26751724, 26999419, 27413557, 27867101, 27886370, 28137660, 28364364, 28473755, 28521179, 28791385, 28823895, 28851339, 29157796, 29186896, 29373817, 29458190, 29550677, 29551049, 29596995, 29626490, 29649711, 29874672, 30142554, 30246290, 30388593, 30457048, 30542302, 30621666, 30659644, 30792491, 30831210, 30946940, 30988377, 31047921, 31291230, 31472433, 31654623, 31734707		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	29590610		★☆☆☆☆ Found in Text Mining only
Prelingual Deafness	Deafness	CTD_human_DG	18607918, 19365690		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	19508998, 28277119		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	17151862, 18242855, 20172629, 23075484, 24070857, 24275008, 24276217, 25737042, 25784293, 26410307, 27071687, 27545218, 27995575, 28469588, 29067329, 29330839, 29698690, 30018265, 30125821, 30182854, 30220011, 30308512, 30634650, 30775992, 30802460, 31349032, 31839607		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	17344400		★☆☆☆☆ Found in Text Mining only
Primary Progressive Aphasia (disorder)	Aphasia	BEFREE	30842294		★☆☆☆☆ Found in Text Mining only
Profound Mental Retardation	Mental retardation	CTD_human_DG	11357950		★☆☆☆☆ Found in Text Mining only
Progressive Muscular Atrophy	Progressive Muscular Atrophy	BEFREE	10202982		★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	20169377, 21997575, 28119573, 30349488, 30487761, 31406011		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	24112788		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10637439, 11911243, 12213679, 21097678, 27456333, 31422041		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	10440874		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27121963, 27456333, 31422041, 34573332	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	27409526, 29315742		★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	25052186		★☆☆☆☆ Found in Text Mining only
Psychomotor Agitation	Psychiatric disorders	Pubtator	24406738	Associate	★☆☆☆☆ Found in Text Mining only
Psychomotor Disorders	Psychiatric disorders	Pubtator	31235756	Associate	★☆☆☆☆ Found in Text Mining only
Psychosis, Brief Reactive	Psychosis	CTD_human_DG	14708030		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	CTD_human_DG	14708030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	BEFREE	14755448, 16389585, 16472361, 17417060, 18319075, 18718885, 19142409, 19462300, 20102668, 20726824, 20736000, 21044653, 21248641, 21305693, 21509595, 21728904, 22192502, 22213405, 22353757, 23327756, 23333821, 23429848, 23748016, 23876786, 24795156, 25246365, 25354496, 26215504, 26603624, 27629407, 28142064, 28472632, 28550022, 28599751, 29584866, 29785763, 29938562, 30629965, 31445421, 31688384, 31822818		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychotic disorders	Pubtator	16472361, 18319075, 19336781, 21509595, 22353757, 22766130, 33053385	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychotic disorders	Pubtator	21672499	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic episodes	Psychosis	BEFREE	23333821		★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26566264, 28744117	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	18069415		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28938915		★☆☆☆☆ Found in Text Mining only
Rasmussen Syndrome	Rasmussen`s Syndrome	BEFREE	29579552		★☆☆☆☆ Found in Text Mining only
Recurrent depressive disorder	Mental Depression	BEFREE	30405261		★☆☆☆☆ Found in Text Mining only
Recurrent major depressive episodes	Mental Depression	BEFREE	21103954, 22194899, 26876488		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	29523900		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	27000219, 29321376, 30300266, 30871541		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	36361771	Associate	★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	34089924	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	16555252, 17973327, 19816090, 28131827, 28901408		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	33942699	Associate	★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	21063127, 25118269, 26477493, 29465286, 31266060		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy of prematurity	Pubtator	25118269	Associate	★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy of prematurity	Pubtator	31266060	Inhibit	★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	16446133, 16446138, 16996699, 18434641, 19096215, 19217433, 19349604, 20951500, 21316312, 23597512, 25147297, 25669997, 27786169, 28254244, 28679669, 28751857, 29321033		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	LHGDN	16962724		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	19349604	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19490633, 22715356, 29126980, 29372349, 29375397, 29787856		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	16315781		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	21059230, 22911740	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	27145455	Associate	★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	CTD_human_DG	14708030		★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	18628679, 19336781, 23512949, 25874530, 28550022, 30181602		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10581496, 11032392, 11343865, 12851636, 12951204, 14623369, 14699963, 15526143, 15543516, 15567073, 15630410, 15647480, 15666411, 15719396, 15768049, 15940304, 15949651, 15952869, 16005437, 16056149, 16386272, 16389585, 16406671, 16472361, 16513879, 16533563, 16581172, 16603474, 16631352, 16741916, 16818862, 16854566, 16897602, 17012697, 17196936, 17239400, 17267117, 17289348, 17413445, 17417060, 17604122, 17720314, 17894414, 17987059, 18056245, 18187310, 18205169, 18325670, 18335055, 18408624, 18472202, 18486103, 18596619, 18602732, 18628679, 18923405, 19018714, 19046988, 19121517, 19207030, 19336781, 19344762, 19359449, 19376528, 19406621, 19457211, 19530966, 19714565, 20061032, 20087404, 20100784, 20420877, 20430595, 20456319, 20553817, 20638435, 20667458, 20708907, 20951727, 20957650, 21044653, 21098877, 21129438, 21223646, 21248641, 21366724, 21464126, 21641949, 21688113, 21710362, 21788944, 21795612, 21917241, 22030467, 22094229, 22213405, 22362486, 22477643, 22521161, 22576830, 22777684, 22845879, 22954755, 23065263, 23157625, 23319002, 23433505, 23438165, 23487199, 23512949, 23532065, 23739121, 23832605, 23923080, 23938174, 23973796, 24069289, 24289908, 24399714, 24468644, 24551075, 24556472, 24595507, 24702539, 24713399, 24935406, 24993285, 25025909, 25125238, 25219617, 25246365, 25264289, 25364290, 25455509, 25476119, 25562189, 25612896, 25681004, 25751398, 25796564, 25874530, 26118823, 26134309, 26503495, 26603468, 26603624, 26700405, 26706021, 26851233, 26889735, 26909392, 27122041, 27262112, 27285059, 27330059, 27409727, 27419650, 27483421, 27501933, 27561148, 27668551, 27712141, 28011898, 28017130, 28070123, 28100419, 28192174, 28235586, 28241130, 28256360, 28342945, 28410959, 28449558, 28509900, 28534294, 28550022, 28562580, 28671000, 28683304, 28734907, 28857598, 28864281, 29050493, 29274733, 29287075, 29306772, 29331787, 29357295, 29366645, 29392373, 29453493, 29482040, 29499969, 29512462, 29584866, 29595641, 29782958, 29896133, 29898578, 30083945, 30172685, 30181602, 30233327, 30246715, 30269004, 30312750, 30375100, 30375508, 30397000, 30456540, 30472504, 30472511, 30584816, 30586536, 30677409, 30710808, 30782512, 30794585, 30909076, 30986693, 31088701, 31098654, 31247244, 31284882, 31399567, 31420036, 31464540, 31465000, 31577039, 31651843, 31655452, 31688384, 31708824, 31711978, 31812959, 31822818, 31849731, 9858028		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	12921913, 14623369, 15630410, 15647480, 15768049, 16005437, 16056149, 16472361, 16533563, 17217930, 17628439, 17869486, 17894414, 17987059, 18056245, 18062171, 18253057, 18408624, 18497099, 18535997, 18856059, 19018714		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	12951204, 14708030, 17442489, 18408624		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	16649215, 16818862, 18056245, 19457211, 20100784, 20161799, 21098877, 22362486, 23253673, 23973796, 24556472, 24802307, 25125238, 25264289, 26118823, 28509900, 29595641, 30375508, 33757426, 34625629, 36473250, 36641432, 37287291, 38385466, 38493363	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	21223646, 24468644, 25476119, 33558459	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia and related disorders	Schizophrenia	BEFREE	28946784		★☆☆☆☆ Found in Text Mining only
Schizophrenia Spectrum and Other Psychotic Disorders	Schizophrenia	Pubtator	16818862	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia, Catatonic	Schizophrenia	BEFREE	16386272		★☆☆☆☆ Found in Text Mining only
Schizophreniform Disorders	Schizophreniform Disorders	CTD_human_DG	14708030		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	38570030	Inhibit	★☆☆☆☆ Found in Text Mining only
SCLEROSING CHOLANGITIS, NEONATAL	Sclerosing Cholangitis	BEFREE	30633395		★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	25874530, 28550022		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	19349604, 20491871, 38203674	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizures	Seizures	Pubtator	20618400	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Senile Plaques	Senile Plaques	BEFREE	23844236, 26605788, 27701410, 31085101, 31144293, 31349032		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	20216530		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	26768428, 28770018, 30720464, 31278527		★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	BEFREE	26010085, 28833192		★☆☆☆☆ Found in Text Mining only
Sexual Dysfunction	Sexual Dysfunction	BEFREE	27787964, 31792367		★☆☆☆☆ Found in Text Mining only
Shared Paranoid Disorder	Shared Paranoid Disorder	BEFREE	26401760		★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	15781040, 21269288, 9073163		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	33708222	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	10844552	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	10844552, 29315742		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	30952206, 36499215	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	25747962, 31142902		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	27166632, 28337282, 30952206		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Deprivation	Sleep deprivation	Pubtator	22379239, 26276912, 28947280	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	24586790	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	27038292, 28656632, 29944703, 31118969		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	23312550, 29748024		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	27852063, 29748024	Associate	★☆☆☆☆ Found in Text Mining only
SMALL PATELLA SYNDROME	SMALL PATELLA SYNDROME	BEFREE	30246290		★☆☆☆☆ Found in Text Mining only
Social Communication Disorder	Social Communication Disorder	BEFREE	20302894		★☆☆☆☆ Found in Text Mining only
Specific Language Disorder	Specific language disorder	Pubtator	20948219	Associate	★☆☆☆☆ Found in Text Mining only
Specific language impairment	Specific Language Impairment	BEFREE	20948219		★☆☆☆☆ Found in Text Mining only
Spherocytosis Type 1	Spherocytosis	Pubtator	20228460	Stimulate	★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	30650149		★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	31741027		★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	26461908		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	30718999		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 6 (disorder)	Spinocerebellar Ataxia	BEFREE	22393909		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	15817657, 19490633		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	15817657	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21147546, 21670725, 29085074, 29861866, 30268558, 31498938, 31777532		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	16951226, 28560678, 28819854		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22276165, 30641914, 35925599, 39412903	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	26926340, 28604655, 31221127		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20101235, 22276165, 29904026, 30641914		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	31019292		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	28447720, 31497919		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	19013140		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	14643774, 19686240, 26954758, 30159899, 30926745, 31560103		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus	Status Epilepticus	CTD_human_DG	8635431, 8821376		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	8635431, 8821376		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	17652166, 30039987, 30585393		★☆☆☆☆ Found in Text Mining only
Stiff-Person Syndrome	Stiff-Person Syndrome	BEFREE	30246290		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29715534, 31172586		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	16367923, 23175149, 27458153, 31339548, 35280682	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	18845611, 22221491, 23240009, 25241287, 25470006, 26381810, 26487176, 29480080, 30338813, 31756156, 32776402, 32996114, 33029116, 33182716, 33306691, 35451419, 35667772, 39494487, 40316184, 40462267	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	17761923, 18797348, 28435271, 29312516, 30459553, 30666179, 31616511		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	LHGDN	17761923		★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	30810826		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	20428771		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	23082852, 24112788, 27701410, 30695686		★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	30723034		★☆☆☆☆ Found in Text Mining only
THROMBOCYTOPENIA 1 (disorder)	Thrombocytopenia	BEFREE	28402427		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	21142662, 29037860, 30146756, 31210313		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	34879183	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	21142662, 29037860, 30146756, 31210313		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	31210313	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	32597152	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	35843716	Associate	★☆☆☆☆ Found in Text Mining only
Tomaculous neuropathy	Hereditary neuropathy with liability to pressure palsies	Pubtator	36430458	Associate	★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	15781040, 21269288, 9073163		★☆☆☆☆ Found in Text Mining only
Tonic-Clonic Epilepsy	Tonic-Clonic Epilepsy	CTD_human_DG	16023256		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	29997237		★☆☆☆☆ Found in Text Mining only
Transposition of Great Vessels	Transposition Of Great Vessels	BEFREE	18692116		★☆☆☆☆ Found in Text Mining only
Tremor	Tremor	Pubtator	22615781	Associate	★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	20951500		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	28158153		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28604807, 28800782, 30796353		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28800782, 32401758	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	11583980		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	11583980	Associate	★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner syndrome	Pubtator	24397357	Stimulate	★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	30245717		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	16005437, 16343697, 16979146, 17036259, 17404118, 17632285, 18179845, 18329817, 18657242, 18721847, 18752720, 18781861, 18852698, 18923405, 19236730, 19414708, 19493959, 19668114, 19699537, 20033742, 20167454, 20207421, 20230085, 20674983, 20682308, 21129438, 21188787, 21218562, 21338649, 21510922, 21692988, 21912391, 21912609, 22033217, 22247094, 22378223, 22681170, 22844024, 22883353, 22965830, 23128924, 23184535, 23250003, 23255668, 23570887, 23603442, 23619509, 23733090, 23968401, 24093582, 24213247, 24683520, 25387785, 25451398, 25510949, 25745134, 25796564, 26078197, 26462036, 26556688, 26717541, 26921055, 26935651, 27212180, 27277475, 27787964, 28301802, 28334675, 28656803, 28688265, 28831019, 28833192, 28837087, 28848102, 28942954, 28977521, 29243873, 29310728, 29387021, 29414128, 29432620, 29450725, 29541037, 29930221, 30219561, 30273985, 30583245, 30640051, 30753865, 30794585, 30905131, 30929061, 31000384, 31027379, 31142907, 31231276, 31295515, 31465895, 31601403, 31636250, 31721892		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	CTD_human_DG	16330021, 21945287		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	22801293, 24577123, 25044977, 25510949, 25658497		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Diseases	Urinary Bladder Diseases	BEFREE	27378135		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25569276, 29402794	Associate	★☆☆☆☆ Found in Text Mining only
Urogenital Abnormalities	Urogenital abnormalities	Pubtator	18753648	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	29989647, 37445902	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	26192455	Associate	★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	15781040, 21269288, 9073163		★☆☆☆☆ Found in Text Mining only
Vitamin A Deficiency	Vitamin A Deficiency	BEFREE	27335034		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	35905107	Associate	★☆☆☆☆ Found in Text Mining only
WAGR Syndrome	WAGR Syndrome	BEFREE	18753648, 19096215, 23266638, 23517654, 27288826, 29061165, 7896291		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WAGR Syndrome	WAGR Syndrome	LHGDN	18753648		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WAGR Syndrome	Wagr syndrome	Pubtator	18753648, 23517654	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WAGR Syndrome	WAGR Syndrome	ORPHANET_DG	23266638		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WAGR syndrome	WAGR Syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Wernicke Encephalopathy	Wernicke Encephalopathy	BEFREE	20194826		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	18753648	Associate	★☆☆☆☆ Found in Text Mining only