RRM2 (ribonucleotide reductase regulatory subunit M2)

Gene

• Entrez ID: 6241
• Gene name: Ribonucleotide reductase regulatory subunit M2
• Gene symbol: RRM2
• Synonyms (NCBI Gene): C2orf48, R2, RR2, RR2M
• Chromosome: 2
• Chromosome location: 2p25.1
• Summary: This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Tr

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005050	hsa-let-7b-5p	Microarray	17699775
MIRT016281	hsa-miR-193b-3p	Microarray	20304954
MIRT020622	hsa-miR-155-5p	Proteomics	18668040
MIRT025270	hsa-miR-34a-5p	Proteomics	21566225
MIRT025270	hsa-miR-34a-5p	Proteomics	21566225
MIRT028473	hsa-miR-30a-5p	Proteomics	18668040
MIRT030469	hsa-miR-24-3p	qRT-PCR;Microarray	19748357
MIRT005050	hsa-let-7b-5p	Proteomics	18668040
MIRT052385	hsa-let-7a-5p	CLASH	23622248
MIRT050154	hsa-miR-26a-5p	CLASH	23622248
MIRT048497	hsa-miR-100-5p	CLASH	23622248
MIRT047887	hsa-miR-30c-5p	CLASH	23622248
MIRT046565	hsa-let-7g-5p	CLASH	23622248
MIRT045271	hsa-miR-186-5p	CLASH	23622248
MIRT043700	hsa-miR-342-3p	CLASH	23622248
MIRT041980	hsa-miR-484	CLASH	23622248
MIRT016281	hsa-miR-193b-3p	CLASH	23622248
MIRT039342	hsa-miR-425-5p	CLASH	23622248
MIRT054803	hsa-miR-211-5p	qRT-PCR	24940696
MIRT052385	hsa-let-7a-5p	qRT-PCR, Luciferase reporter assay, Western blot	23335963
MIRT052385	hsa-let-7a-5p	qRT-PCR, Luciferase reporter assay, Western blot	23335963
MIRT722690	hsa-miR-6873-5p	HITS-CLIP	19536157
MIRT722689	hsa-miR-1321	HITS-CLIP	19536157
MIRT722688	hsa-miR-4739	HITS-CLIP	19536157
MIRT722687	hsa-miR-4756-5p	HITS-CLIP	19536157
MIRT722686	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT722685	hsa-miR-6795-3p	HITS-CLIP	19536157
MIRT722684	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT722683	hsa-miR-4794	HITS-CLIP	19536157
MIRT722682	hsa-miR-664a-5p	HITS-CLIP	19536157
MIRT722681	hsa-miR-149-5p	HITS-CLIP	19536157
MIRT154970	hsa-miR-3064-5p	HITS-CLIP	19536157
MIRT154974	hsa-miR-6504-5p	HITS-CLIP	19536157
MIRT722680	hsa-miR-4419a	HITS-CLIP	19536157
MIRT722679	hsa-miR-4510	HITS-CLIP	19536157
MIRT722678	hsa-miR-6127	HITS-CLIP	19536157
MIRT722677	hsa-miR-6129	HITS-CLIP	19536157
MIRT722676	hsa-miR-6130	HITS-CLIP	19536157
MIRT722675	hsa-miR-6133	HITS-CLIP	19536157
MIRT722674	hsa-miR-3184-5p	HITS-CLIP	19536157
MIRT722673	hsa-miR-423-5p	HITS-CLIP	19536157
MIRT722672	hsa-miR-6778-3p	HITS-CLIP	19536157
MIRT722671	hsa-miR-149-3p	HITS-CLIP	19536157
MIRT722670	hsa-miR-4728-5p	HITS-CLIP	19536157
MIRT722669	hsa-miR-6785-5p	HITS-CLIP	19536157
MIRT722668	hsa-miR-6883-5p	HITS-CLIP	19536157
MIRT722667	hsa-miR-6826-3p	HITS-CLIP	19536157
MIRT468842	hsa-miR-302f	PAR-CLIP	21572407
MIRT468841	hsa-miR-6888-5p	PAR-CLIP	21572407
MIRT468840	hsa-miR-4802-5p	PAR-CLIP	21572407
MIRT118914	hsa-miR-4768-3p	PAR-CLIP	21572407
MIRT468839	hsa-miR-665	PAR-CLIP	21572407
MIRT468838	hsa-miR-6840-3p	PAR-CLIP	21572407
MIRT297031	hsa-miR-219b-3p	PAR-CLIP	21572407
MIRT468835	hsa-miR-4534	PAR-CLIP	21572407
MIRT468836	hsa-miR-8082	PAR-CLIP	21572407
MIRT468829	hsa-miR-1273e	PAR-CLIP	21572407
MIRT297022	hsa-miR-4458	PAR-CLIP	21572407
MIRT297023	hsa-miR-4500	PAR-CLIP	21572407
MIRT297015	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT005050	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT297017	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT046565	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT297014	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT297013	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT297012	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT297011	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT052385	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT297024	hsa-miR-6768-5p	PAR-CLIP	21572407
MIRT546646	hsa-miR-4700-3p	PAR-CLIP	21572407
MIRT154963	hsa-miR-3169	PAR-CLIP	21572407
MIRT297020	hsa-miR-4328	PAR-CLIP	21572407
MIRT546645	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT154965	hsa-miR-4515	PAR-CLIP	21572407
MIRT546644	hsa-miR-323b-5p	PAR-CLIP	21572407
MIRT546643	hsa-miR-410-5p	PAR-CLIP	21572407
MIRT546642	hsa-miR-494-5p	PAR-CLIP	21572407
MIRT154964	hsa-miR-4316	PAR-CLIP	21572407
MIRT297019	hsa-miR-1294	PAR-CLIP	21572407
MIRT084370	hsa-miR-4672	PAR-CLIP	21572407
MIRT084344	hsa-miR-20a-5p	PAR-CLIP	23592263
MIRT084346	hsa-miR-106a-5p	PAR-CLIP	23592263
MIRT084347	hsa-miR-106b-5p	PAR-CLIP	23592263
MIRT084343	hsa-miR-17-5p	PAR-CLIP	23592263
MIRT084349	hsa-miR-20b-5p	PAR-CLIP	23592263
MIRT084351	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT084345	hsa-miR-93-5p	PAR-CLIP	23592263
MIRT084350	hsa-miR-526b-3p	PAR-CLIP	23592263
MIRT154968	hsa-miR-4668-3p	PAR-CLIP	23592263
MIRT468848	hsa-miR-3609	PAR-CLIP	23592263
MIRT468847	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT468846	hsa-miR-4796-3p	PAR-CLIP	23592263
MIRT154950	hsa-miR-33a-3p	PAR-CLIP	23592263
MIRT154967	hsa-miR-4520-5p	PAR-CLIP	23592263
MIRT084352	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT028473	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT154952	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT047887	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT154951	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT154956	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT468845	hsa-miR-8068	PAR-CLIP	23592263
MIRT468844	hsa-miR-7843-3p	PAR-CLIP	23592263
MIRT468843	hsa-miR-127-5p	PAR-CLIP	23592263
MIRT084353	hsa-miR-5006-5p	PAR-CLIP	23592263
MIRT084354	hsa-miR-6083	PAR-CLIP	23592263
MIRT468842	hsa-miR-302f	PAR-CLIP	23592263
MIRT468841	hsa-miR-6888-5p	PAR-CLIP	23592263
MIRT468840	hsa-miR-4802-5p	PAR-CLIP	23592263
MIRT118914	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT468839	hsa-miR-665	PAR-CLIP	23592263
MIRT468838	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT297031	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT468837	hsa-miR-655-5p	PAR-CLIP	23592263
MIRT468835	hsa-miR-4534	PAR-CLIP	23592263
MIRT468836	hsa-miR-8082	PAR-CLIP	23592263
MIRT468834	hsa-miR-3689d	PAR-CLIP	23592263
MIRT468833	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT468832	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT468831	hsa-miR-582-5p	PAR-CLIP	23592263
MIRT468830	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT468829	hsa-miR-1273e	PAR-CLIP	23592263
MIRT084347	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT084344	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT084347	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT084343	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT084349	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT084345	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT084351	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT084344	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT028473	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT154952	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT047887	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT154951	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT154956	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT154952	hsa-miR-30b-5p	Immunohistochemistry (IHC), Luciferase reporter assay, Western blotting	34096637
MIRT737192	hsa-miR-21-3p	RNA-seq, qRT-PCR	31621912
MIRT722690	hsa-miR-6873-5p	HITS-CLIP	19536157
MIRT722689	hsa-miR-1321	HITS-CLIP	19536157
MIRT722688	hsa-miR-4739	HITS-CLIP	19536157
MIRT722687	hsa-miR-4756-5p	HITS-CLIP	19536157
MIRT722686	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT722685	hsa-miR-6795-3p	HITS-CLIP	19536157
MIRT722684	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT722683	hsa-miR-4794	HITS-CLIP	19536157
MIRT722682	hsa-miR-664a-5p	HITS-CLIP	19536157
MIRT722681	hsa-miR-149-5p	HITS-CLIP	19536157
MIRT154970	hsa-miR-3064-5p	HITS-CLIP	19536157
MIRT154974	hsa-miR-6504-5p	HITS-CLIP	19536157
MIRT722680	hsa-miR-4419a	HITS-CLIP	19536157
MIRT722679	hsa-miR-4510	HITS-CLIP	19536157
MIRT722678	hsa-miR-6127	HITS-CLIP	19536157
MIRT722677	hsa-miR-6129	HITS-CLIP	19536157
MIRT722676	hsa-miR-6130	HITS-CLIP	19536157
MIRT722675	hsa-miR-6133	HITS-CLIP	19536157
MIRT722674	hsa-miR-3184-5p	HITS-CLIP	19536157
MIRT722673	hsa-miR-423-5p	HITS-CLIP	19536157
MIRT722672	hsa-miR-6778-3p	HITS-CLIP	19536157
MIRT722671	hsa-miR-149-3p	HITS-CLIP	19536157
MIRT722670	hsa-miR-4728-5p	HITS-CLIP	19536157
MIRT722669	hsa-miR-6785-5p	HITS-CLIP	19536157
MIRT722668	hsa-miR-6883-5p	HITS-CLIP	19536157
MIRT722667	hsa-miR-6826-3p	HITS-CLIP	19536157
MIRT468842	hsa-miR-302f	PAR-CLIP	21572407
MIRT468841	hsa-miR-6888-5p	PAR-CLIP	21572407
MIRT468840	hsa-miR-4802-5p	PAR-CLIP	21572407
MIRT118914	hsa-miR-4768-3p	PAR-CLIP	21572407
MIRT468839	hsa-miR-665	PAR-CLIP	21572407
MIRT468838	hsa-miR-6840-3p	PAR-CLIP	21572407
MIRT297031	hsa-miR-219b-3p	PAR-CLIP	21572407
MIRT468835	hsa-miR-4534	PAR-CLIP	21572407
MIRT468836	hsa-miR-8082	PAR-CLIP	21572407
MIRT468829	hsa-miR-1273e	PAR-CLIP	21572407
MIRT297022	hsa-miR-4458	PAR-CLIP	21572407
MIRT297023	hsa-miR-4500	PAR-CLIP	21572407
MIRT297015	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT005050	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT297017	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT046565	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT297014	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT297013	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT297012	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT297011	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT052385	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT297024	hsa-miR-6768-5p	PAR-CLIP	21572407
MIRT546646	hsa-miR-4700-3p	PAR-CLIP	21572407
MIRT154963	hsa-miR-3169	PAR-CLIP	21572407
MIRT297020	hsa-miR-4328	PAR-CLIP	21572407
MIRT546645	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT154965	hsa-miR-4515	PAR-CLIP	21572407
MIRT546644	hsa-miR-323b-5p	PAR-CLIP	21572407
MIRT546643	hsa-miR-410-5p	PAR-CLIP	21572407
MIRT546642	hsa-miR-494-5p	PAR-CLIP	21572407
MIRT154964	hsa-miR-4316	PAR-CLIP	21572407
MIRT297019	hsa-miR-1294	PAR-CLIP	21572407
MIRT084370	hsa-miR-4672	PAR-CLIP	21572407
MIRT084344	hsa-miR-20a-5p	PAR-CLIP	23592263
MIRT084346	hsa-miR-106a-5p	PAR-CLIP	23592263
MIRT084347	hsa-miR-106b-5p	PAR-CLIP	23592263
MIRT084343	hsa-miR-17-5p	PAR-CLIP	23592263
MIRT084349	hsa-miR-20b-5p	PAR-CLIP	23592263
MIRT084351	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT084345	hsa-miR-93-5p	PAR-CLIP	23592263
MIRT084350	hsa-miR-526b-3p	PAR-CLIP	23592263
MIRT154968	hsa-miR-4668-3p	PAR-CLIP	23592263
MIRT468848	hsa-miR-3609	PAR-CLIP	23592263
MIRT468847	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT468846	hsa-miR-4796-3p	PAR-CLIP	23592263
MIRT154950	hsa-miR-33a-3p	PAR-CLIP	23592263
MIRT154967	hsa-miR-4520-5p	PAR-CLIP	23592263
MIRT084352	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT028473	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT154952	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT047887	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT154951	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT154956	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT468845	hsa-miR-8068	PAR-CLIP	23592263
MIRT468844	hsa-miR-7843-3p	PAR-CLIP	23592263
MIRT468843	hsa-miR-127-5p	PAR-CLIP	23592263
MIRT084353	hsa-miR-5006-5p	PAR-CLIP	23592263
MIRT084354	hsa-miR-6083	PAR-CLIP	23592263
MIRT468842	hsa-miR-302f	PAR-CLIP	23592263
MIRT468841	hsa-miR-6888-5p	PAR-CLIP	23592263
MIRT468840	hsa-miR-4802-5p	PAR-CLIP	23592263
MIRT118914	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT468839	hsa-miR-665	PAR-CLIP	23592263
MIRT468838	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT297031	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT468837	hsa-miR-655-5p	PAR-CLIP	23592263
MIRT468835	hsa-miR-4534	PAR-CLIP	23592263
MIRT468836	hsa-miR-8082	PAR-CLIP	23592263
MIRT468834	hsa-miR-3689d	PAR-CLIP	23592263
MIRT468833	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT468832	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT468831	hsa-miR-582-5p	PAR-CLIP	23592263
MIRT468830	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT468829	hsa-miR-1273e	PAR-CLIP	23592263
MIRT756114	hsa-miR-582-3p	Luciferase reporter assay, Western blotting, qRT-PCR	35609318
MIRT052385	hsa-let-7a-5p	Luciferase reporter assay	37596700
MIRT1319688	hsa-let-7a	CLIP-seq
MIRT1319689	hsa-let-7b	CLIP-seq
MIRT1319690	hsa-let-7c	CLIP-seq
MIRT1319691	hsa-let-7d	CLIP-seq
MIRT1319692	hsa-let-7e	CLIP-seq
MIRT1319693	hsa-let-7f	CLIP-seq
MIRT1319694	hsa-let-7g	CLIP-seq
MIRT1319695	hsa-let-7i	CLIP-seq
MIRT1319696	hsa-miR-106a	CLIP-seq
MIRT1319697	hsa-miR-106b	CLIP-seq
MIRT1319698	hsa-miR-1207-3p	CLIP-seq
MIRT1319699	hsa-miR-1237	CLIP-seq
MIRT1319700	hsa-miR-1245b-5p	CLIP-seq
MIRT1319701	hsa-miR-1257	CLIP-seq
MIRT1319702	hsa-miR-125a-5p	CLIP-seq
MIRT1319703	hsa-miR-125b	CLIP-seq
MIRT1319704	hsa-miR-1262	CLIP-seq
MIRT1319705	hsa-miR-1273f	CLIP-seq
MIRT1319706	hsa-miR-1279	CLIP-seq
MIRT1319707	hsa-miR-1285	CLIP-seq
MIRT1319708	hsa-miR-1293	CLIP-seq
MIRT1319709	hsa-miR-1305	CLIP-seq
MIRT1319710	hsa-miR-1324	CLIP-seq
MIRT1319711	hsa-miR-134	CLIP-seq
MIRT1319712	hsa-miR-140-5p	CLIP-seq
MIRT1319713	hsa-miR-141	CLIP-seq
MIRT1319714	hsa-miR-143	CLIP-seq
MIRT1319715	hsa-miR-146b-3p	CLIP-seq
MIRT1319716	hsa-miR-17	CLIP-seq
MIRT1319717	hsa-miR-200a	CLIP-seq
MIRT1319718	hsa-miR-202	CLIP-seq
MIRT1319719	hsa-miR-204	CLIP-seq
MIRT1319720	hsa-miR-2053	CLIP-seq
MIRT1319721	hsa-miR-208a	CLIP-seq
MIRT1319722	hsa-miR-208b	CLIP-seq
MIRT1319723	hsa-miR-20a	CLIP-seq
MIRT1319724	hsa-miR-20b	CLIP-seq
MIRT1319725	hsa-miR-211	CLIP-seq
MIRT1319726	hsa-miR-219-2-3p	CLIP-seq
MIRT1319727	hsa-miR-23a	CLIP-seq
MIRT1319728	hsa-miR-23b	CLIP-seq
MIRT1319729	hsa-miR-23c	CLIP-seq
MIRT1319730	hsa-miR-2467-5p	CLIP-seq
MIRT1319731	hsa-miR-2964a-3p	CLIP-seq
MIRT1319732	hsa-miR-298	CLIP-seq
MIRT1319733	hsa-miR-30a	CLIP-seq
MIRT1319734	hsa-miR-30b	CLIP-seq
MIRT1319735	hsa-miR-30c	CLIP-seq
MIRT1319736	hsa-miR-30d	CLIP-seq
MIRT1319737	hsa-miR-30e	CLIP-seq
MIRT1319738	hsa-miR-3118	CLIP-seq
MIRT1319739	hsa-miR-3122	CLIP-seq
MIRT1319740	hsa-miR-3126-3p	CLIP-seq
MIRT1319741	hsa-miR-3128	CLIP-seq
MIRT1319742	hsa-miR-3136-5p	CLIP-seq
MIRT1319743	hsa-miR-3142	CLIP-seq
MIRT1319744	hsa-miR-3148	CLIP-seq
MIRT1319745	hsa-miR-3157-3p	CLIP-seq
MIRT1319746	hsa-miR-3160-3p	CLIP-seq
MIRT1319747	hsa-miR-3162-5p	CLIP-seq
MIRT1319748	hsa-miR-3165	CLIP-seq
MIRT1319749	hsa-miR-3173-5p	CLIP-seq
MIRT1319750	hsa-miR-3187-5p	CLIP-seq
MIRT1319751	hsa-miR-3188	CLIP-seq
MIRT1319752	hsa-miR-323-3p	CLIP-seq
MIRT1319753	hsa-miR-331-5p	CLIP-seq
MIRT1319754	hsa-miR-34b	CLIP-seq
MIRT1319755	hsa-miR-3545-5p	CLIP-seq
MIRT1319756	hsa-miR-3606	CLIP-seq
MIRT1319757	hsa-miR-3611	CLIP-seq
MIRT1319758	hsa-miR-3613-5p	CLIP-seq
MIRT1319759	hsa-miR-3618	CLIP-seq
MIRT1319760	hsa-miR-3619-3p	CLIP-seq
MIRT1319761	hsa-miR-3622a-3p	CLIP-seq
MIRT1319762	hsa-miR-3622b-3p	CLIP-seq
MIRT1319763	hsa-miR-3650	CLIP-seq
MIRT1319764	hsa-miR-3658	CLIP-seq
MIRT1319765	hsa-miR-3672	CLIP-seq
MIRT1319766	hsa-miR-3685	CLIP-seq
MIRT1319767	hsa-miR-3688-3p	CLIP-seq
MIRT1319768	hsa-miR-3689a-3p	CLIP-seq
MIRT1319769	hsa-miR-3689c	CLIP-seq
MIRT1319770	hsa-miR-376c	CLIP-seq
MIRT1319771	hsa-miR-384	CLIP-seq
MIRT1319772	hsa-miR-3913-5p	CLIP-seq
MIRT1319773	hsa-miR-3920	CLIP-seq
MIRT1319774	hsa-miR-3929	CLIP-seq
MIRT1319775	hsa-miR-3975	CLIP-seq
MIRT1319776	hsa-miR-409-3p	CLIP-seq
MIRT1319777	hsa-miR-4252	CLIP-seq
MIRT1319778	hsa-miR-4259	CLIP-seq
MIRT1319779	hsa-miR-4261	CLIP-seq
MIRT1319780	hsa-miR-4272	CLIP-seq
MIRT1319781	hsa-miR-4282	CLIP-seq
MIRT1319782	hsa-miR-4293	CLIP-seq
MIRT1319783	hsa-miR-4303	CLIP-seq
MIRT1319784	hsa-miR-4312	CLIP-seq
MIRT1319785	hsa-miR-4319	CLIP-seq
MIRT1319786	hsa-miR-4324	CLIP-seq
MIRT1319787	hsa-miR-4329	CLIP-seq
MIRT1319788	hsa-miR-4419b	CLIP-seq
MIRT1319789	hsa-miR-4421	CLIP-seq
MIRT1319790	hsa-miR-4432	CLIP-seq
MIRT1319791	hsa-miR-4433	CLIP-seq
MIRT1319792	hsa-miR-4439	CLIP-seq
MIRT1319793	hsa-miR-4446-5p	CLIP-seq
MIRT1319794	hsa-miR-4448	CLIP-seq
MIRT1319795	hsa-miR-4459	CLIP-seq
MIRT1319796	hsa-miR-4460	CLIP-seq
MIRT1319797	hsa-miR-4470	CLIP-seq
MIRT1319798	hsa-miR-4474-3p	CLIP-seq
MIRT1319799	hsa-miR-4474-5p	CLIP-seq
MIRT1319800	hsa-miR-4478	CLIP-seq
MIRT1319801	hsa-miR-4483	CLIP-seq
MIRT1319802	hsa-miR-4487	CLIP-seq
MIRT1319803	hsa-miR-4496	CLIP-seq
MIRT1319804	hsa-miR-4499	CLIP-seq
MIRT1319805	hsa-miR-4513	CLIP-seq
MIRT1319806	hsa-miR-4519	CLIP-seq
MIRT1319807	hsa-miR-4520a-5p	CLIP-seq
MIRT1319808	hsa-miR-4520b-5p	CLIP-seq
MIRT1319809	hsa-miR-4527	CLIP-seq
MIRT1319810	hsa-miR-4639-5p	CLIP-seq
MIRT1319811	hsa-miR-4643	CLIP-seq
MIRT1319812	hsa-miR-4650-5p	CLIP-seq
MIRT1319813	hsa-miR-466	CLIP-seq
MIRT1319814	hsa-miR-4662a-3p	CLIP-seq
MIRT1319815	hsa-miR-4666-5p	CLIP-seq
MIRT1319816	hsa-miR-4670-3p	CLIP-seq
MIRT1319817	hsa-miR-4678	CLIP-seq
MIRT1319818	hsa-miR-4696	CLIP-seq
MIRT1319819	hsa-miR-4701-3p	CLIP-seq
MIRT1319820	hsa-miR-4708-5p	CLIP-seq
MIRT1319821	hsa-miR-4712-3p	CLIP-seq
MIRT1319822	hsa-miR-4715-5p	CLIP-seq
MIRT1319823	hsa-miR-4720-5p	CLIP-seq
MIRT1319824	hsa-miR-4727-3p	CLIP-seq
MIRT1319825	hsa-miR-4731-3p	CLIP-seq
MIRT1319826	hsa-miR-4738-3p	CLIP-seq
MIRT1319827	hsa-miR-4740-5p	CLIP-seq
MIRT1319828	hsa-miR-4742-3p	CLIP-seq
MIRT1319829	hsa-miR-4755-5p	CLIP-seq
MIRT1319830	hsa-miR-4756-3p	CLIP-seq
MIRT1319831	hsa-miR-4760-3p	CLIP-seq
MIRT1319832	hsa-miR-4762-3p	CLIP-seq
MIRT1319833	hsa-miR-4770	CLIP-seq
MIRT1319834	hsa-miR-4782-5p	CLIP-seq
MIRT1319835	hsa-miR-4788	CLIP-seq
MIRT1319836	hsa-miR-4789-3p	CLIP-seq
MIRT1319837	hsa-miR-4789-5p	CLIP-seq
MIRT1319838	hsa-miR-4790-3p	CLIP-seq
MIRT1319839	hsa-miR-4793-3p	CLIP-seq
MIRT1319840	hsa-miR-4797-5p	CLIP-seq
MIRT1319841	hsa-miR-4799-3p	CLIP-seq
MIRT1319842	hsa-miR-4801	CLIP-seq
MIRT1319843	hsa-miR-485-5p	CLIP-seq
MIRT1319844	hsa-miR-487a	CLIP-seq
MIRT1319845	hsa-miR-495	CLIP-seq
MIRT1319846	hsa-miR-499-5p	CLIP-seq
MIRT1319847	hsa-miR-500a	CLIP-seq
MIRT1319848	hsa-miR-502-5p	CLIP-seq
MIRT1319849	hsa-miR-508-5p	CLIP-seq
MIRT1319850	hsa-miR-513a-3p	CLIP-seq
MIRT1319851	hsa-miR-519d	CLIP-seq
MIRT1319852	hsa-miR-522	CLIP-seq
MIRT1319853	hsa-miR-544b	CLIP-seq
MIRT1319854	hsa-miR-548a-3p	CLIP-seq
MIRT1319855	hsa-miR-548aa	CLIP-seq
MIRT1319856	hsa-miR-548ac	CLIP-seq
MIRT1319857	hsa-miR-548ae	CLIP-seq
MIRT1319858	hsa-miR-548ah	CLIP-seq
MIRT1319859	hsa-miR-548aj	CLIP-seq
MIRT1319860	hsa-miR-548am	CLIP-seq
MIRT1319861	hsa-miR-548c-3p	CLIP-seq
MIRT1319862	hsa-miR-548d-3p	CLIP-seq
MIRT1319863	hsa-miR-548e	CLIP-seq
MIRT1319864	hsa-miR-548f	CLIP-seq
MIRT1319865	hsa-miR-548g	CLIP-seq
MIRT1319866	hsa-miR-548x	CLIP-seq
MIRT1319867	hsa-miR-548z	CLIP-seq
MIRT1319868	hsa-miR-552	CLIP-seq
MIRT1319869	hsa-miR-558	CLIP-seq
MIRT1319870	hsa-miR-561	CLIP-seq
MIRT1319871	hsa-miR-569	CLIP-seq
MIRT1319872	hsa-miR-577	CLIP-seq
MIRT1319873	hsa-miR-579	CLIP-seq
MIRT756114	hsa-miR-582-3p	CLIP-seq
MIRT1319874	hsa-miR-612	CLIP-seq
MIRT1319875	hsa-miR-623	CLIP-seq
MIRT1319876	hsa-miR-634	CLIP-seq
MIRT1319877	hsa-miR-644	CLIP-seq
MIRT1319878	hsa-miR-649	CLIP-seq
MIRT1319879	hsa-miR-661	CLIP-seq
MIRT1319880	hsa-miR-664	CLIP-seq
MIRT1319881	hsa-miR-766	CLIP-seq
MIRT1319882	hsa-miR-874	CLIP-seq
MIRT1319883	hsa-miR-889	CLIP-seq
MIRT1319884	hsa-miR-892b	CLIP-seq
MIRT1319885	hsa-miR-921	CLIP-seq
MIRT1319886	hsa-miR-93	CLIP-seq
MIRT1319887	hsa-miR-98	CLIP-seq
MIRT1319704	hsa-miR-1262	CLIP-seq
MIRT1319709	hsa-miR-1305	CLIP-seq
MIRT1319711	hsa-miR-134	CLIP-seq
MIRT1319719	hsa-miR-204	CLIP-seq
MIRT1319725	hsa-miR-211	CLIP-seq
MIRT1319732	hsa-miR-298	CLIP-seq
MIRT1319738	hsa-miR-3118	CLIP-seq
MIRT1319742	hsa-miR-3136-5p	CLIP-seq
MIRT1319746	hsa-miR-3160-3p	CLIP-seq
MIRT1319753	hsa-miR-331-5p	CLIP-seq
MIRT1319888	hsa-miR-3646	CLIP-seq
MIRT1319770	hsa-miR-376c	CLIP-seq
MIRT1319773	hsa-miR-3920	CLIP-seq
MIRT1319781	hsa-miR-4282	CLIP-seq
MIRT1319783	hsa-miR-4303	CLIP-seq
MIRT1319792	hsa-miR-4439	CLIP-seq
MIRT1319793	hsa-miR-4446-5p	CLIP-seq
MIRT1319802	hsa-miR-4487	CLIP-seq
MIRT1319803	hsa-miR-4496	CLIP-seq
MIRT1319805	hsa-miR-4513	CLIP-seq
MIRT1319809	hsa-miR-4527	CLIP-seq
MIRT1319816	hsa-miR-4670-3p	CLIP-seq
MIRT1319817	hsa-miR-4678	CLIP-seq
MIRT1319819	hsa-miR-4701-3p	CLIP-seq
MIRT1319827	hsa-miR-4740-5p	CLIP-seq
MIRT1319829	hsa-miR-4755-5p	CLIP-seq
MIRT1319832	hsa-miR-4762-3p	CLIP-seq
MIRT1319889	hsa-miR-4764-3p	CLIP-seq
MIRT1319837	hsa-miR-4789-5p	CLIP-seq
MIRT1319847	hsa-miR-500a	CLIP-seq
MIRT1319850	hsa-miR-513a-3p	CLIP-seq
MIRT1319852	hsa-miR-522	CLIP-seq
MIRT1319868	hsa-miR-552	CLIP-seq
MIRT1319869	hsa-miR-558	CLIP-seq
MIRT1319872	hsa-miR-577	CLIP-seq
MIRT1319875	hsa-miR-623	CLIP-seq
MIRT1319883	hsa-miR-889	CLIP-seq
MIRT1319740	hsa-miR-3126-3p	CLIP-seq
MIRT1319741	hsa-miR-3128	CLIP-seq
MIRT1319789	hsa-miR-4421	CLIP-seq
MIRT1319823	hsa-miR-4720-5p	CLIP-seq
MIRT1319841	hsa-miR-4799-3p	CLIP-seq
MIRT1319878	hsa-miR-649	CLIP-seq
MIRT1319835	hsa-miR-4788	CLIP-seq
MIRT1319688	hsa-let-7a	CLIP-seq
MIRT1319689	hsa-let-7b	CLIP-seq
MIRT1319690	hsa-let-7c	CLIP-seq
MIRT1319691	hsa-let-7d	CLIP-seq
MIRT1319692	hsa-let-7e	CLIP-seq
MIRT1319693	hsa-let-7f	CLIP-seq
MIRT1319694	hsa-let-7g	CLIP-seq
MIRT1319695	hsa-let-7i	CLIP-seq
MIRT1319701	hsa-miR-1257	CLIP-seq
MIRT1319705	hsa-miR-1273f	CLIP-seq
MIRT1319707	hsa-miR-1285	CLIP-seq
MIRT1319708	hsa-miR-1293	CLIP-seq
MIRT2095005	hsa-miR-1323	CLIP-seq
MIRT1319710	hsa-miR-1324	CLIP-seq
MIRT1319713	hsa-miR-141	CLIP-seq
MIRT1319717	hsa-miR-200a	CLIP-seq
MIRT1319718	hsa-miR-202	CLIP-seq
MIRT1319726	hsa-miR-219-2-3p	CLIP-seq
MIRT1319731	hsa-miR-2964a-3p	CLIP-seq
MIRT1319739	hsa-miR-3122	CLIP-seq
MIRT2095006	hsa-miR-3123	CLIP-seq
MIRT1319741	hsa-miR-3128	CLIP-seq
MIRT1319744	hsa-miR-3148	CLIP-seq
MIRT2095007	hsa-miR-3157-5p	CLIP-seq
MIRT1319748	hsa-miR-3165	CLIP-seq
MIRT1319750	hsa-miR-3187-5p	CLIP-seq
MIRT1319753	hsa-miR-331-5p	CLIP-seq
MIRT1319756	hsa-miR-3606	CLIP-seq
MIRT1319757	hsa-miR-3611	CLIP-seq
MIRT1319759	hsa-miR-3618	CLIP-seq
MIRT1319761	hsa-miR-3622a-3p	CLIP-seq
MIRT1319762	hsa-miR-3622b-3p	CLIP-seq
MIRT1319763	hsa-miR-3650	CLIP-seq
MIRT1319767	hsa-miR-3688-3p	CLIP-seq
MIRT1319768	hsa-miR-3689a-3p	CLIP-seq
MIRT1319769	hsa-miR-3689c	CLIP-seq
MIRT1319772	hsa-miR-3913-5p	CLIP-seq
MIRT2095008	hsa-miR-3914	CLIP-seq
MIRT2095009	hsa-miR-3919	CLIP-seq
MIRT1319777	hsa-miR-4252	CLIP-seq
MIRT2095010	hsa-miR-4257	CLIP-seq
MIRT1319778	hsa-miR-4259	CLIP-seq
MIRT2095011	hsa-miR-4277	CLIP-seq
MIRT1319791	hsa-miR-4433	CLIP-seq
MIRT1319795	hsa-miR-4459	CLIP-seq
MIRT1319797	hsa-miR-4470	CLIP-seq
MIRT1319798	hsa-miR-4474-3p	CLIP-seq
MIRT1319799	hsa-miR-4474-5p	CLIP-seq
MIRT2095012	hsa-miR-4480	CLIP-seq
MIRT1319801	hsa-miR-4483	CLIP-seq
MIRT1319805	hsa-miR-4513	CLIP-seq
MIRT1319817	hsa-miR-4678	CLIP-seq
MIRT2095013	hsa-miR-4691-3p	CLIP-seq
MIRT1319821	hsa-miR-4712-3p	CLIP-seq
MIRT1319822	hsa-miR-4715-5p	CLIP-seq
MIRT1319823	hsa-miR-4720-5p	CLIP-seq
MIRT1319825	hsa-miR-4731-3p	CLIP-seq
MIRT1319827	hsa-miR-4740-5p	CLIP-seq
MIRT1319837	hsa-miR-4789-5p	CLIP-seq
MIRT1319839	hsa-miR-4793-3p	CLIP-seq
MIRT1319841	hsa-miR-4799-3p	CLIP-seq
MIRT1319842	hsa-miR-4801	CLIP-seq
MIRT1319843	hsa-miR-485-5p	CLIP-seq
MIRT2095014	hsa-miR-486-3p	CLIP-seq
MIRT1319849	hsa-miR-508-5p	CLIP-seq
MIRT2095015	hsa-miR-510	CLIP-seq
MIRT2095016	hsa-miR-512-5p	CLIP-seq
MIRT1319853	hsa-miR-544b	CLIP-seq
MIRT1319861	hsa-miR-548c-3p	CLIP-seq
MIRT2095017	hsa-miR-548o	CLIP-seq
MIRT1319870	hsa-miR-561	CLIP-seq
MIRT1319874	hsa-miR-612	CLIP-seq
MIRT1319876	hsa-miR-634	CLIP-seq
MIRT1319877	hsa-miR-644	CLIP-seq
MIRT1319879	hsa-miR-661	CLIP-seq
MIRT1319881	hsa-miR-766	CLIP-seq
MIRT1319883	hsa-miR-889	CLIP-seq
MIRT1319885	hsa-miR-921	CLIP-seq
MIRT1319887	hsa-miR-98	CLIP-seq
MIRT1319688	hsa-let-7a	CLIP-seq
MIRT1319689	hsa-let-7b	CLIP-seq
MIRT1319690	hsa-let-7c	CLIP-seq
MIRT1319691	hsa-let-7d	CLIP-seq
MIRT1319692	hsa-let-7e	CLIP-seq
MIRT1319693	hsa-let-7f	CLIP-seq
MIRT1319694	hsa-let-7g	CLIP-seq
MIRT1319695	hsa-let-7i	CLIP-seq
MIRT1319696	hsa-miR-106a	CLIP-seq
MIRT1319697	hsa-miR-106b	CLIP-seq
MIRT2319349	hsa-miR-1197	CLIP-seq
MIRT1319699	hsa-miR-1237	CLIP-seq
MIRT1319700	hsa-miR-1245b-5p	CLIP-seq
MIRT1319701	hsa-miR-1257	CLIP-seq
MIRT1319707	hsa-miR-1285	CLIP-seq
MIRT1319708	hsa-miR-1293	CLIP-seq
MIRT1319710	hsa-miR-1324	CLIP-seq
MIRT2319350	hsa-miR-138	CLIP-seq
MIRT1319713	hsa-miR-141	CLIP-seq
MIRT1319716	hsa-miR-17	CLIP-seq
MIRT2319351	hsa-miR-1911	CLIP-seq
MIRT2319352	hsa-miR-1915	CLIP-seq
MIRT2319353	hsa-miR-197	CLIP-seq
MIRT1319717	hsa-miR-200a	CLIP-seq
MIRT1319718	hsa-miR-202	CLIP-seq
MIRT1319720	hsa-miR-2053	CLIP-seq
MIRT1319721	hsa-miR-208a	CLIP-seq
MIRT1319722	hsa-miR-208b	CLIP-seq
MIRT1319723	hsa-miR-20a	CLIP-seq
MIRT1319724	hsa-miR-20b	CLIP-seq
MIRT1319726	hsa-miR-219-2-3p	CLIP-seq
MIRT2319354	hsa-miR-224	CLIP-seq
MIRT1319730	hsa-miR-2467-5p	CLIP-seq
MIRT1319731	hsa-miR-2964a-3p	CLIP-seq
MIRT1319733	hsa-miR-30a	CLIP-seq
MIRT1319734	hsa-miR-30b	CLIP-seq
MIRT1319735	hsa-miR-30c	CLIP-seq
MIRT1319736	hsa-miR-30d	CLIP-seq
MIRT1319737	hsa-miR-30e	CLIP-seq
MIRT2319355	hsa-miR-31	CLIP-seq
MIRT2319356	hsa-miR-3117-5p	CLIP-seq
MIRT1319739	hsa-miR-3122	CLIP-seq
MIRT2095006	hsa-miR-3123	CLIP-seq
MIRT1319740	hsa-miR-3126-3p	CLIP-seq
MIRT1319741	hsa-miR-3128	CLIP-seq
MIRT1319743	hsa-miR-3142	CLIP-seq
MIRT2319357	hsa-miR-3156-5p	CLIP-seq
MIRT2095007	hsa-miR-3157-5p	CLIP-seq
MIRT1319748	hsa-miR-3165	CLIP-seq
MIRT1319750	hsa-miR-3187-5p	CLIP-seq
MIRT1319751	hsa-miR-3188	CLIP-seq
MIRT2319358	hsa-miR-3194-5p	CLIP-seq
MIRT1319752	hsa-miR-323-3p	CLIP-seq
MIRT1319753	hsa-miR-331-5p	CLIP-seq
MIRT1319754	hsa-miR-34b	CLIP-seq
MIRT1319756	hsa-miR-3606	CLIP-seq
MIRT1319757	hsa-miR-3611	CLIP-seq
MIRT1319758	hsa-miR-3613-5p	CLIP-seq
MIRT1319759	hsa-miR-3618	CLIP-seq
MIRT1319761	hsa-miR-3622a-3p	CLIP-seq
MIRT1319762	hsa-miR-3622b-3p	CLIP-seq
MIRT1319763	hsa-miR-3650	CLIP-seq
MIRT1319764	hsa-miR-3658	CLIP-seq
MIRT1319768	hsa-miR-3689a-3p	CLIP-seq
MIRT1319769	hsa-miR-3689c	CLIP-seq
MIRT1319772	hsa-miR-3913-5p	CLIP-seq
MIRT2095009	hsa-miR-3919	CLIP-seq
MIRT1319775	hsa-miR-3975	CLIP-seq
MIRT1319776	hsa-miR-409-3p	CLIP-seq
MIRT1319777	hsa-miR-4252	CLIP-seq
MIRT2095010	hsa-miR-4257	CLIP-seq
MIRT1319778	hsa-miR-4259	CLIP-seq
MIRT1319780	hsa-miR-4272	CLIP-seq
MIRT2095011	hsa-miR-4277	CLIP-seq
MIRT1319784	hsa-miR-4312	CLIP-seq
MIRT1319790	hsa-miR-4432	CLIP-seq
MIRT1319791	hsa-miR-4433	CLIP-seq
MIRT2319359	hsa-miR-4436a	CLIP-seq
MIRT1319795	hsa-miR-4459	CLIP-seq
MIRT1319797	hsa-miR-4470	CLIP-seq
MIRT1319798	hsa-miR-4474-3p	CLIP-seq
MIRT1319799	hsa-miR-4474-5p	CLIP-seq
MIRT2095012	hsa-miR-4480	CLIP-seq
MIRT1319801	hsa-miR-4483	CLIP-seq
MIRT2319360	hsa-miR-4509	CLIP-seq
MIRT1319805	hsa-miR-4513	CLIP-seq
MIRT1319806	hsa-miR-4519	CLIP-seq
MIRT1319807	hsa-miR-4520a-5p	CLIP-seq
MIRT1319808	hsa-miR-4520b-5p	CLIP-seq
MIRT1319810	hsa-miR-4639-5p	CLIP-seq
MIRT1319811	hsa-miR-4643	CLIP-seq
MIRT1319812	hsa-miR-4650-5p	CLIP-seq
MIRT1319813	hsa-miR-466	CLIP-seq
MIRT1319815	hsa-miR-4666-5p	CLIP-seq
MIRT1319817	hsa-miR-4678	CLIP-seq
MIRT2319361	hsa-miR-4687-3p	CLIP-seq
MIRT2319362	hsa-miR-4688	CLIP-seq
MIRT2095013	hsa-miR-4691-3p	CLIP-seq
MIRT1319818	hsa-miR-4696	CLIP-seq
MIRT1319821	hsa-miR-4712-3p	CLIP-seq
MIRT1319822	hsa-miR-4715-5p	CLIP-seq
MIRT1319823	hsa-miR-4720-5p	CLIP-seq
MIRT2319363	hsa-miR-4726-3p	CLIP-seq
MIRT1319825	hsa-miR-4731-3p	CLIP-seq
MIRT1319827	hsa-miR-4740-5p	CLIP-seq
MIRT2319364	hsa-miR-4769-3p	CLIP-seq
MIRT2319365	hsa-miR-4777-3p	CLIP-seq
MIRT1319835	hsa-miR-4788	CLIP-seq
MIRT1319836	hsa-miR-4789-3p	CLIP-seq
MIRT1319837	hsa-miR-4789-5p	CLIP-seq
MIRT1319839	hsa-miR-4793-3p	CLIP-seq
MIRT1319841	hsa-miR-4799-3p	CLIP-seq
MIRT1319842	hsa-miR-4801	CLIP-seq
MIRT1319843	hsa-miR-485-5p	CLIP-seq
MIRT2095014	hsa-miR-486-3p	CLIP-seq
MIRT2319366	hsa-miR-486-5p	CLIP-seq
MIRT1319846	hsa-miR-499-5p	CLIP-seq
MIRT1319849	hsa-miR-508-5p	CLIP-seq
MIRT2319367	hsa-miR-5096	CLIP-seq
MIRT2095015	hsa-miR-510	CLIP-seq
MIRT2095016	hsa-miR-512-5p	CLIP-seq
MIRT1319851	hsa-miR-519d	CLIP-seq
MIRT2319368	hsa-miR-532-3p	CLIP-seq
MIRT1319853	hsa-miR-544b	CLIP-seq
MIRT1319856	hsa-miR-548ac	CLIP-seq
MIRT1319857	hsa-miR-548ae	CLIP-seq
MIRT1319858	hsa-miR-548ah	CLIP-seq
MIRT1319859	hsa-miR-548aj	CLIP-seq
MIRT1319860	hsa-miR-548am	CLIP-seq
MIRT1319861	hsa-miR-548c-3p	CLIP-seq
MIRT1319862	hsa-miR-548d-3p	CLIP-seq
MIRT1319866	hsa-miR-548x	CLIP-seq
MIRT1319867	hsa-miR-548z	CLIP-seq
MIRT1319871	hsa-miR-569	CLIP-seq
MIRT1319873	hsa-miR-579	CLIP-seq
MIRT756114	hsa-miR-582-3p	CLIP-seq
MIRT1319874	hsa-miR-612	CLIP-seq
MIRT1319876	hsa-miR-634	CLIP-seq
MIRT1319877	hsa-miR-644	CLIP-seq
MIRT1319879	hsa-miR-661	CLIP-seq
MIRT2319369	hsa-miR-668	CLIP-seq
MIRT2319370	hsa-miR-718	CLIP-seq
MIRT1319881	hsa-miR-766	CLIP-seq
MIRT1319883	hsa-miR-889	CLIP-seq
MIRT1319884	hsa-miR-892b	CLIP-seq
MIRT1319885	hsa-miR-921	CLIP-seq
MIRT1319886	hsa-miR-93	CLIP-seq
MIRT1319887	hsa-miR-98	CLIP-seq
MIRT1319688	hsa-let-7a	CLIP-seq
MIRT1319689	hsa-let-7b	CLIP-seq
MIRT1319690	hsa-let-7c	CLIP-seq
MIRT1319691	hsa-let-7d	CLIP-seq
MIRT1319692	hsa-let-7e	CLIP-seq
MIRT1319693	hsa-let-7f	CLIP-seq
MIRT1319694	hsa-let-7g	CLIP-seq
MIRT1319695	hsa-let-7i	CLIP-seq
MIRT1319710	hsa-miR-1324	CLIP-seq
MIRT1319718	hsa-miR-202	CLIP-seq
MIRT1319720	hsa-miR-2053	CLIP-seq
MIRT1319726	hsa-miR-219-2-3p	CLIP-seq
MIRT1319731	hsa-miR-2964a-3p	CLIP-seq
MIRT2319355	hsa-miR-31	CLIP-seq
MIRT1319741	hsa-miR-3128	CLIP-seq
MIRT2319357	hsa-miR-3156-5p	CLIP-seq
MIRT1319748	hsa-miR-3165	CLIP-seq
MIRT1319753	hsa-miR-331-5p	CLIP-seq
MIRT1319756	hsa-miR-3606	CLIP-seq
MIRT1319805	hsa-miR-4513	CLIP-seq
MIRT1319806	hsa-miR-4519	CLIP-seq
MIRT1319817	hsa-miR-4678	CLIP-seq
MIRT2319362	hsa-miR-4688	CLIP-seq
MIRT1319823	hsa-miR-4720-5p	CLIP-seq
MIRT1319825	hsa-miR-4731-3p	CLIP-seq
MIRT1319827	hsa-miR-4740-5p	CLIP-seq
MIRT1319837	hsa-miR-4789-5p	CLIP-seq
MIRT1319841	hsa-miR-4799-3p	CLIP-seq
MIRT1319842	hsa-miR-4801	CLIP-seq
MIRT1319871	hsa-miR-569	CLIP-seq
MIRT1319876	hsa-miR-634	CLIP-seq
MIRT1319883	hsa-miR-889	CLIP-seq
MIRT1319885	hsa-miR-921	CLIP-seq
MIRT1319887	hsa-miR-98	CLIP-seq
MIRT2458623	hsa-miR-3675-3p	CLIP-seq
MIRT2458624	hsa-miR-3934	CLIP-seq
MIRT2458625	hsa-miR-4662a-5p	CLIP-seq
MIRT2458626	hsa-miR-4676-5p	CLIP-seq
MIRT2458627	hsa-miR-4684-5p	CLIP-seq
MIRT1319826	hsa-miR-4738-3p	CLIP-seq
MIRT1319861	hsa-miR-548c-3p	CLIP-seq
MIRT2458628	hsa-miR-575	CLIP-seq
MIRT1319707	hsa-miR-1285	CLIP-seq
MIRT1319708	hsa-miR-1293	CLIP-seq
MIRT1319739	hsa-miR-3122	CLIP-seq
MIRT1319748	hsa-miR-3165	CLIP-seq
MIRT1319750	hsa-miR-3187-5p	CLIP-seq
MIRT2615028	hsa-miR-3613-3p	CLIP-seq
MIRT1319761	hsa-miR-3622a-3p	CLIP-seq
MIRT1319762	hsa-miR-3622b-3p	CLIP-seq
MIRT2458623	hsa-miR-3675-3p	CLIP-seq
MIRT1319768	hsa-miR-3689a-3p	CLIP-seq
MIRT1319769	hsa-miR-3689c	CLIP-seq
MIRT2615029	hsa-miR-371-5p	CLIP-seq
MIRT2615030	hsa-miR-371b-5p	CLIP-seq
MIRT1319772	hsa-miR-3913-5p	CLIP-seq
MIRT2458624	hsa-miR-3934	CLIP-seq
MIRT1319777	hsa-miR-4252	CLIP-seq
MIRT1319801	hsa-miR-4483	CLIP-seq
MIRT2458625	hsa-miR-4662a-5p	CLIP-seq
MIRT2458626	hsa-miR-4676-5p	CLIP-seq
MIRT2458627	hsa-miR-4684-5p	CLIP-seq
MIRT1319826	hsa-miR-4738-3p	CLIP-seq
MIRT1319839	hsa-miR-4793-3p	CLIP-seq
MIRT1319849	hsa-miR-508-5p	CLIP-seq
MIRT1319853	hsa-miR-544b	CLIP-seq
MIRT1319861	hsa-miR-548c-3p	CLIP-seq
MIRT2458628	hsa-miR-575	CLIP-seq
MIRT1319874	hsa-miR-612	CLIP-seq
MIRT1319879	hsa-miR-661	CLIP-seq
MIRT1319881	hsa-miR-766	CLIP-seq
MIRT1319707	hsa-miR-1285	CLIP-seq
MIRT1319708	hsa-miR-1293	CLIP-seq
MIRT1319739	hsa-miR-3122	CLIP-seq
MIRT1319748	hsa-miR-3165	CLIP-seq
MIRT1319750	hsa-miR-3187-5p	CLIP-seq
MIRT2615028	hsa-miR-3613-3p	CLIP-seq
MIRT1319761	hsa-miR-3622a-3p	CLIP-seq
MIRT1319762	hsa-miR-3622b-3p	CLIP-seq
MIRT2458623	hsa-miR-3675-3p	CLIP-seq
MIRT1319768	hsa-miR-3689a-3p	CLIP-seq
MIRT1319769	hsa-miR-3689c	CLIP-seq
MIRT2615029	hsa-miR-371-5p	CLIP-seq
MIRT2615030	hsa-miR-371b-5p	CLIP-seq
MIRT1319772	hsa-miR-3913-5p	CLIP-seq
MIRT2458624	hsa-miR-3934	CLIP-seq
MIRT1319777	hsa-miR-4252	CLIP-seq
MIRT1319791	hsa-miR-4433	CLIP-seq
MIRT1319795	hsa-miR-4459	CLIP-seq
MIRT1319801	hsa-miR-4483	CLIP-seq
MIRT2458625	hsa-miR-4662a-5p	CLIP-seq
MIRT2458626	hsa-miR-4676-5p	CLIP-seq
MIRT2458627	hsa-miR-4684-5p	CLIP-seq
MIRT1319826	hsa-miR-4738-3p	CLIP-seq
MIRT1319839	hsa-miR-4793-3p	CLIP-seq
MIRT1319849	hsa-miR-508-5p	CLIP-seq
MIRT1319853	hsa-miR-544b	CLIP-seq
MIRT1319861	hsa-miR-548c-3p	CLIP-seq
MIRT2458628	hsa-miR-575	CLIP-seq
MIRT1319874	hsa-miR-612	CLIP-seq
MIRT1319879	hsa-miR-661	CLIP-seq
MIRT1319881	hsa-miR-766	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Activation	19416980

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001824	Process	Blastocyst development	IEA
GO:0004748	Function	Ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor	IBA
GO:0004748	Function	Ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor	IEA
GO:0004748	Function	Ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor	IEA
GO:0004748	Function	Ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor	ISS
GO:0004748	Function	Ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor	NAS	1627826
GO:0005515	Function	Protein binding	IPI	17726094, 21336276, 22632967, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	18997010
GO:0005829	Component	Cytosol	TAS
GO:0005971	Component	Ribonucleoside-diphosphate reductase complex	IEA
GO:0005971	Component	Ribonucleoside-diphosphate reductase complex	IPI	22632967
GO:0008199	Function	Ferric iron binding	IEA
GO:0009185	Process	Ribonucleoside diphosphate metabolic process	IDA	16376858
GO:0009185	Process	Ribonucleoside diphosphate metabolic process	IEA
GO:0009262	Process	Deoxyribonucleotide metabolic process	IEA
GO:0009263	Process	Deoxyribonucleotide biosynthetic process	IBA
GO:0009263	Process	Deoxyribonucleotide biosynthetic process	IEA
GO:0009263	Process	Deoxyribonucleotide biosynthetic process	ISS
GO:0009265	Process	2'-deoxyribonucleotide biosynthetic process	IDA	16376858
GO:0009265	Process	2'-deoxyribonucleotide biosynthetic process	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051290	Process	Protein heterotetramerization	IEA
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IDA	24253041
GO:1901992	Process	Positive regulation of mitotic cell cycle phase transition	IEA

Other IDs

• MIM: 180390
• HGNC: 10452
• e!Ensembl: ENSG00000171848

Protein

• UniProt ID: P31350
• Protein name: Ribonucleoside-diphosphate reductase subunit M2 (EC 1.17.4.1) (Ribonucleotide reductase small chain) (Ribonucleotide reductase small subunit)
• Protein function: Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. Inhibits Wnt signaling.
• PDB: 2UW2, 3OLJ, 3VPM, 3VPN, 3VPO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00268	Ribonuc_red_sm	79 → 346	Ribonucleotide reductase, small chain	Domain

• Sequence:

  MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKT
  KAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLK
  PEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLI
  DTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSF
  ASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIE
  QEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFMENISLEGKTN
  FFEKRVGEYQRMGVMSSPTENSFTLDADF

• Sequence length: 389

Pathways

KEGG:

Purine metabolism
Pyrimidine metabolism
Glutathione metabolism
Drug metabolism - other enzymes
Metabolic pathways
Nucleotide metabolism
p53 signaling pathway

Reactome:

Interconversion of nucleotide di- and triphosphates
G1/S-Specific Transcription
Transcriptional Regulation by E2F6

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	LHGDN	14661056, 18414411		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	18414411		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	27602772		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	14661056, 15300189		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	31732966		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	35500219	Associate	★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	31363169		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	23300771, 28705014, 28793209, 31241884		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	24497641, 28793209	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	20927319, 23335963, 28339085, 31672935		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	31363169		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30106091, 36717858	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35200126	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	34088958	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21166702, 25695839		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18587273, 19377877, 25016594, 25227663, 28782484, 30457164, 30556899, 31621912		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12938148, 18587273, 18820369, 19377877, 23497539, 25016594, 25756514, 31895772, 32053082, 33455094, 33499770, 33823519, 34384030, 34675265, 34986845, 35290409, 36997866, 39242688	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23002339, 24637958, 35609310	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	26453115	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25368754, 30106091, 30702595, 31043166, 31822116, 31936661, 32769939, 33380233, 34238253, 34324544, 34746301, 35964907, 36002253, 36304446, 36518297, 37461802, 39563436	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36713030	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	21166702, 25695839		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24200970, 34794761	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	20927319	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31348324, 31422942, 32309427, 33686951, 34606125, 35339898, 35896362	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34319001	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36247089	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22884145, 24200970, 31729978		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	23056178, 23704896		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	24423925, 24637958, 31169309		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	24423925, 24637958, 31169309		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28640074		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31728969		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	15814641		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20473941, 21415168, 21873171, 23113760, 26093293, 27801665, 29114070		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	15814641		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20473941, 23002339, 23113760, 25368754, 27733154, 34120619, 34986845, 35757968	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31118677		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	21166702		★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	33318199	Associate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	36997866	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31056798, 31650984		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	22884145, 24200970		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	30362638		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	27796194		★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	23300771		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27655637, 27845331, 29592883, 29667764, 30568233, 31119182		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27655637, 31119182, 37196077	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27655637, 27845331, 29592883, 29667764, 30568233, 31119182		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27655637		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27655637, 36750807	Associate	★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	26715915	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	BEFREE	22342644, 23719266		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	23719266	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	34096637	Associate	★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	15361213		★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	15361213	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	34319001	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	24024897, 35439288	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	22517893, 24024897	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24024897		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	18230555, 28284560		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20798514, 24060417, 28640074, 29710515, 31638225		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	25368754	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28640074		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	34096637	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18414411, 26001082, 31789390, 32638267, 37115505	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23002339	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33823519, 37863324	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	31358475		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18587273, 19377877, 25016594, 25213022, 25227663, 28782484, 30457164, 30556899, 31621912		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23719266		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22884145, 31729978		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23335963, 27517489, 28797284, 30777929		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18941749, 24360663, 30996073		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20825972, 24756820, 27348973		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21166702, 25695839		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18587273, 21165954, 23113760, 23719266, 24637958, 25738429, 26093293, 27297629, 27348973, 27801665, 28379442, 31729978		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	28556483		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	24423925, 24637958, 31169309		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31728969		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20944646, 27297629		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20944646, 23562156, 36130505	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	21157382	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	31322175		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	31322175	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	35546402, 36315425	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	24192812		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	38038045	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	31233186		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25695839, 28906488		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14661056, 15143080, 15300189, 16585222, 16596201, 18414411, 18941749, 22342644, 23335963, 24200970, 24756820, 25016594, 26093293, 26333382, 27348973, 27796194, 27801665, 28556483, 29275122, 29667764, 30362638, 30518875, 31169309, 31324785, 31819489		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	24348903	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23384725		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	28556483, 37837931	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18414411, 19002265, 22342644, 23719266, 25227663, 26663950, 26718430, 31696057, 31819489		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22884145, 31729978		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31729978, 34577856	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23335963, 27517489, 28797284, 30777929		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	19531250, 23335963		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17224927, 22670179, 22760605, 23335963, 27517489, 27748721, 30777929	Associate	★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	31348324		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	40240887	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	18941749, 24360663, 30996073		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18941749, 31225930, 32385899, 35409038, 35812443, 37596700	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31118677		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	33217867, 34646884	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	28507282		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30106091		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	31649026, 33191406, 37599787, 40478628	Associate	★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	35958619	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	33186389	Stimulate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	37395033	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21166702		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22203927, 23719266	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	29853661		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	22342644, 23719266		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20825972, 24756820, 27348973		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18941749	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32638267, 32902196	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26453115, 40420140	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	40179432	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35685866	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	21166702		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24637958, 30816541, 33302814, 35609310, 37344577	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32922202	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	35757968	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	28502800, 36401415	Associate	★☆☆☆☆ Found in Text Mining only