Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6238
Gene name	Ribosome binding protein 1
Gene symbol	RRBP1
Synonyms (NCBI Gene)	ES/130ES130RRphESp180
Chromosome	20
Chromosome location	20p12.1
Summary	This gene encodes a ribosome-binding protein of the endoplasmic reticulum (ER) membrane. Studies suggest that this gene plays a role in ER proliferation, secretory pathways and secretory cell differentiation, and mediation of ER-microtubule interactions.

107

Show/Hide all (107)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005285	hsa-miR-1-3p	pSILAC	18668040
MIRT016910	hsa-miR-335-5p	Microarray	18185580
MIRT005285	hsa-miR-1-3p	Proteomics;Other	18668040
MIRT025298	hsa-miR-34a-5p	Proteomics	21566225
MIRT052004	hsa-let-7b-5p	CLASH	23622248
MIRT049448	hsa-miR-92a-3p	CLASH	23622248
MIRT043513	hsa-miR-331-3p	CLASH	23622248
MIRT1319476	hsa-miR-1324	CLIP-seq
MIRT1319477	hsa-miR-146a	CLIP-seq
MIRT1319478	hsa-miR-146b-5p	CLIP-seq
MIRT1319479	hsa-miR-182	CLIP-seq
MIRT1319480	hsa-miR-25	CLIP-seq
MIRT1319481	hsa-miR-3184	CLIP-seq
MIRT1319482	hsa-miR-32	CLIP-seq
MIRT1319483	hsa-miR-363	CLIP-seq
MIRT1319484	hsa-miR-3660	CLIP-seq
MIRT1319485	hsa-miR-367	CLIP-seq
MIRT1319486	hsa-miR-3925-3p	CLIP-seq
MIRT1319487	hsa-miR-423-5p	CLIP-seq
MIRT1319488	hsa-miR-4258	CLIP-seq
MIRT1319489	hsa-miR-4286	CLIP-seq
MIRT1319490	hsa-miR-4325	CLIP-seq
MIRT1319491	hsa-miR-4526	CLIP-seq
MIRT1319492	hsa-miR-4675	CLIP-seq
MIRT1319493	hsa-miR-4710	CLIP-seq
MIRT1319494	hsa-miR-4741	CLIP-seq
MIRT1319495	hsa-miR-4757-5p	CLIP-seq
MIRT1319496	hsa-miR-4758-3p	CLIP-seq
MIRT1319497	hsa-miR-580	CLIP-seq
MIRT1319498	hsa-miR-589	CLIP-seq
MIRT1319499	hsa-miR-663b	CLIP-seq
MIRT1319500	hsa-miR-92a	CLIP-seq
MIRT1319501	hsa-miR-92b	CLIP-seq
MIRT2094925	hsa-miR-223	CLIP-seq
MIRT2094926	hsa-miR-4277	CLIP-seq
MIRT2094927	hsa-miR-4459	CLIP-seq
MIRT1319496	hsa-miR-4758-3p	CLIP-seq
MIRT1319499	hsa-miR-663b	CLIP-seq
MIRT2094928	hsa-miR-665	CLIP-seq
MIRT2094929	hsa-miR-668	CLIP-seq
MIRT2442574	hsa-miR-188-3p	CLIP-seq
MIRT2442575	hsa-miR-329	CLIP-seq
MIRT2442576	hsa-miR-339-3p	CLIP-seq
MIRT2442577	hsa-miR-362-3p	CLIP-seq
MIRT2442578	hsa-miR-4508	CLIP-seq
MIRT2442579	hsa-miR-532-3p	CLIP-seq
MIRT2614978	hsa-miR-1299	CLIP-seq
MIRT2614979	hsa-miR-1307	CLIP-seq
MIRT2614980	hsa-miR-135a	CLIP-seq
MIRT2614981	hsa-miR-135b	CLIP-seq
MIRT2614982	hsa-miR-1538	CLIP-seq
MIRT2442574	hsa-miR-188-3p	CLIP-seq
MIRT2614983	hsa-miR-3158-3p	CLIP-seq
MIRT2614984	hsa-miR-3182	CLIP-seq
MIRT2614985	hsa-miR-3202	CLIP-seq
MIRT2442575	hsa-miR-329	CLIP-seq
MIRT2442576	hsa-miR-339-3p	CLIP-seq
MIRT2442577	hsa-miR-362-3p	CLIP-seq
MIRT2614986	hsa-miR-3682-5p	CLIP-seq
MIRT2614987	hsa-miR-4255	CLIP-seq
MIRT2614988	hsa-miR-4283	CLIP-seq
MIRT2614989	hsa-miR-4474-3p	CLIP-seq
MIRT2614990	hsa-miR-4489	CLIP-seq
MIRT2442578	hsa-miR-4508	CLIP-seq
MIRT2614991	hsa-miR-4532	CLIP-seq
MIRT2614992	hsa-miR-4533	CLIP-seq
MIRT1319492	hsa-miR-4675	CLIP-seq
MIRT2614993	hsa-miR-4685-5p	CLIP-seq
MIRT2614994	hsa-miR-4729	CLIP-seq
MIRT1319494	hsa-miR-4741	CLIP-seq
MIRT2614995	hsa-miR-4745-3p	CLIP-seq
MIRT2614996	hsa-miR-493	CLIP-seq
MIRT2614997	hsa-miR-520d-5p	CLIP-seq
MIRT2614998	hsa-miR-524-5p	CLIP-seq
MIRT2442579	hsa-miR-532-3p	CLIP-seq
MIRT2614999	hsa-miR-579	CLIP-seq
MIRT2615000	hsa-miR-593	CLIP-seq
MIRT2615001	hsa-miR-604	CLIP-seq
MIRT2615002	hsa-miR-642b	CLIP-seq
MIRT1319499	hsa-miR-663b	CLIP-seq
MIRT2094929	hsa-miR-668	CLIP-seq
MIRT2615003	hsa-miR-759	CLIP-seq
MIRT2615004	hsa-miR-760	CLIP-seq
MIRT2615005	hsa-miR-875-3p	CLIP-seq
MIRT2615006	hsa-miR-934	CLIP-seq
MIRT2614978	hsa-miR-1299	CLIP-seq
MIRT2614980	hsa-miR-135a	CLIP-seq
MIRT2614981	hsa-miR-135b	CLIP-seq
MIRT2614984	hsa-miR-3182	CLIP-seq
MIRT2614985	hsa-miR-3202	CLIP-seq
MIRT2614986	hsa-miR-3682-5p	CLIP-seq
MIRT2614988	hsa-miR-4283	CLIP-seq
MIRT2614989	hsa-miR-4474-3p	CLIP-seq
MIRT2614990	hsa-miR-4489	CLIP-seq
MIRT2614992	hsa-miR-4533	CLIP-seq
MIRT2614994	hsa-miR-4729	CLIP-seq
MIRT2690035	hsa-miR-4768-5p	CLIP-seq
MIRT2614996	hsa-miR-493	CLIP-seq
MIRT2614997	hsa-miR-520d-5p	CLIP-seq
MIRT2614998	hsa-miR-524-5p	CLIP-seq
MIRT2614999	hsa-miR-579	CLIP-seq
MIRT2615000	hsa-miR-593	CLIP-seq
MIRT2615002	hsa-miR-642b	CLIP-seq
MIRT2615004	hsa-miR-760	CLIP-seq
MIRT2615005	hsa-miR-875-3p	CLIP-seq
MIRT2615006	hsa-miR-934	CLIP-seq
MIRT2690036	hsa-miR-942	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001649	Process	Osteoblast differentiation	HDA	16210410
GO:0003723	Function	RNA binding	HDA	22681889
GO:0005515	Function	Protein binding	IPI	30021884, 36950384
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	NAS	9628588
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005840	Component	Ribosome	TAS	9628588
GO:0006412	Process	Translation	TAS	9628588
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	HDA	16210410
GO:0016020	Component	Membrane	IEA
GO:0038023	Function	Signaling receptor activity	TAS	9628588

MIM	HGNC	e!Ensembl
601418	10448	ENSG00000125844

Q9P2E9

Protein name

Ribosome-binding protein 1 (180 kDa ribosome receptor homolog) (RRp) (ES/130-related protein) (Ribosome receptor protein)

Protein function

Acts as a ribosome receptor and mediates interaction between the ribosome and the endoplasmic reticulum membrane.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05104	Rib_recp_KP_reg	33 → 171	Ribosome receptor lysine/proline rich region	Family

Sequence

MDIYDTQTLGVVVFGGFMVVSAIGIFLVSTFSMKETSYEEALANQRKEMAKTHHQKVEKK
KKEKTVEKKGKTKKKEEKPNGKIPDHDPAPNVTVLLREPVRAPAVAVAPTPVQPPIIVAP
VATVPAMPQEKLASSPKDKKKKEKKVAKVEPAVSSVVNSIQVLTSKAAILETAPKEVPMV
VVPPVGAKGNTPATGTTQGKKAEGTQNQSKKAEGAPNQGRKAEGTPNQGKKTEGTPNQGK
KAEGTPNQGKKAEGTPNQGKKAEGAQNQGKKVDTTPNQGKKVEGAPTQGRKAEGAQNQAK
KVEGAQNQGKKAEGAQNQGKKGEGAQNQGKKAEGAQNQGKKAEGAQNQGKKAEGAQNQGK
KAEGAQNQGKKAEGAQNQGKKAEGAQNQGKKVEGAQNQGKKAEGAQNQGKKAEGAQNQGK
KAEGAQNQGKKAEGAQNQGKKAEGAQNQGKKAEGAQNQGKKAEGAQNQGKKVEGAQNQGK
KAEGAQNQGKKAEGAQNQGKKAEGAQNQGQKGEGAQNQGKKTEGAQGKKAERSPNQGKKG
EGAPIQGKKADSVANQGTKVEGITNQGKKAEGSPSEGKKAEGSPNQGKKADAAANQGKKT
ESASVQGRNTDVAQSPEAPKQEAPAKKKSGSKKKGEPGPPDADGPLYLPYKTLVSTVGSM
VFNEGEAQRLIEILSEKAGIIQDTWHKATQKGDPVAILKRQLEEKEKLLATEQEDAAVAK
SKLRELNKEMAAEKAKAAAGEAKVKKQLVAREQEITAVQARMQASYREHVKEVQQLQGKI
RTLQEQLENGPNTQLARLQQENSILRDALNQATSQVESKQNAELAKLRQELSKVSKELVE
KSEAVRQDEQQRKALEAKAAAFEKQVLQLQASHRESEEALQKRLDEVSRELCHTQSSHAS
LRADAEKAQEQQQQMAELHSKLQSSEAEVRSKCEELSGLHGQLQEARAENSQLTERIRSI
EALLEAGQARDAQDVQASQAEADQQQTRLKELESQVSGLEKEAIELREAVEQQKVKNNDL
REKNWKAMEALATAEQACKEKLLSLTQAKEESEKQLCLIEAQTMEALLALLPELSVLAQQ
NYTEWLQDLKEKGPTLLKHPPAPAEPSSDLASKLREAEETQSTLQAECDQYRSILAETEG
MLRDLQKSVEEEEQVWRAKVGAAEEELQKSRVTVKHLEEIVEKLKGELESSDQVREHTSH
LEAELEKHMAAASAECQNYAKEVAGLRQLLLESQSQLDAAKSEAQKQSDELALVRQQLSE
MKSHVEDGDIAGAPASSPEAPPAEQDPVQLKTQLEWTEAILEDEQTQRQKLTAEFEEAQT
SACRLQEELEKLRTAGPLESSETEEASQLKERLEKEKKLTSDLGRAATRLQELLKTTQEQ
LAREKDTVKKLQEQLEKAEDGSSSKEGTSV

Sequence length

1410

Interactions

View interactions

	KEGG
	Protein processing in endoplasmic reticulum

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (16)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FRONTOTEMPORAL DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOOTH DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (50)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	26045779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	17541270, 31558464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25845758	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30684972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35640677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	30684972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	30684972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27447629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	31285390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	32536673	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31285390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	19472396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30684972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30684972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30684972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	30684972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	17541270, 19472396, 31489115, 8857931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	28802988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31285390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29844703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	30684972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22004682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22004682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypereosinophilia	Hypereosinophilia	BEFREE	25398061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypereosinophilic syndrome	Hypereosinophilic Syndrome	BEFREE	17549478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	29692610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Hypereosinophilic Syndrome	Hypereosinophilic Syndrome	BEFREE	17549478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29199540, 30254452, 31693630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	28918518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16871543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30684972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25845758, 31285390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30684972, 32536673	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	19608752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31357893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30325597, 31118771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15951288, 29804063, 31285390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17541270, 19472396, 27723025, 28009146, 31157652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21744479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	25845758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30151623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37580018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30325597, 31118771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	35513865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	27874193		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	27803312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	31489115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	29804063		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	25398061		★★★★★ ★☆☆☆☆ Found in Text Mining only

RRBP1 (ribosome binding protein 1)