RRAS (RAS related)

Gene

• Entrez ID: 6237
• Gene name: RAS related
• Gene symbol: RRAS
• Synonyms (NCBI Gene): R-Ras, RRAS1
• Chromosome: 19
• Chromosome location: 19q13.33
• Summary: The protein encoded by this gene is a small GTPase involved in diverse processes including angiogenesis, vascular homeostasis and regeneration, cell adhesion, and neuronal axon guidance. Mutations in this gene are found in many invasive cancers. [provided

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022156	hsa-miR-124-3p	Microarray	18668037
MIRT025259	hsa-miR-34a-5p	Sequencing	20371350
MIRT022156	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	24861879
MIRT022156	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	24861879
MIRT731696	hsa-miR-449a	Immunocytochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26381333
MIRT731696	hsa-miR-449a	Immunocytochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26381333
MIRT731696	hsa-miR-449a	Immunocytochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26381333
MIRT731696	hsa-miR-449a	Immunocytochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26381333
MIRT1319469	hsa-miR-124	CLIP-seq
MIRT1319470	hsa-miR-128	CLIP-seq
MIRT1319471	hsa-miR-298	CLIP-seq
MIRT1319472	hsa-miR-34a	CLIP-seq
MIRT1319473	hsa-miR-34c-5p	CLIP-seq
MIRT1319474	hsa-miR-449b	CLIP-seq
MIRT1319475	hsa-miR-506	CLIP-seq
MIRT1553188	hsa-miR-4733-3p	CLIP-seq
MIRT2094918	hsa-miR-1343	CLIP-seq
MIRT2094919	hsa-miR-3120-3p	CLIP-seq
MIRT2094920	hsa-miR-3192	CLIP-seq
MIRT2094921	hsa-miR-3657	CLIP-seq
MIRT2094922	hsa-miR-3928	CLIP-seq
MIRT2094923	hsa-miR-4501	CLIP-seq
MIRT2094924	hsa-miR-4669	CLIP-seq
MIRT2094923	hsa-miR-4501	CLIP-seq
MIRT2393896	hsa-miR-18a	CLIP-seq
MIRT2393897	hsa-miR-18b	CLIP-seq
MIRT2094919	hsa-miR-3120-3p	CLIP-seq
MIRT2393898	hsa-miR-3144-5p	CLIP-seq
MIRT2393899	hsa-miR-3191	CLIP-seq
MIRT2393900	hsa-miR-377	CLIP-seq
MIRT2393901	hsa-miR-4652-5p	CLIP-seq
MIRT1553188	hsa-miR-4733-3p	CLIP-seq
MIRT2393902	hsa-miR-4735-3p	CLIP-seq
MIRT2393903	hsa-miR-4761-5p	CLIP-seq
MIRT2393904	hsa-miR-491-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002521	Process	Leukocyte differentiation	IMP	24705357
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	16773572
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	IMP	24705357
GO:0003924	Function	GTPase activity	TAS	3098437
GO:0005515	Function	Protein binding	IPI	17474147, 19843518, 32296183
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007165	Process	Signal transduction	IEA
GO:0007265	Process	Ras protein signal transduction	IEA
GO:0007265	Process	Ras protein signal transduction	TAS	3098437
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	22825554
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019003	Function	GDP binding	IBA
GO:0019003	Function	GDP binding	IDA	16773572
GO:0019003	Function	GDP binding	IMP	24705357
GO:0036135	Process	Schwann cell migration	IEA
GO:0044877	Function	Protein-containing complex binding	IDA	23209302
GO:0045766	Process	Positive regulation of angiogenesis	IMP	21393242
GO:0051896	Process	Regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	24705357
GO:0060325	Process	Face morphogenesis	IMP	24705357
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	IMP	24705357
GO:1900148	Process	Negative regulation of Schwann cell migration	IEA
GO:1904906	Process	Positive regulation of endothelial cell-matrix adhesion via fibronectin	IMP	22825554
GO:2001214	Process	Positive regulation of vasculogenesis	IMP	22825554

Other IDs

• MIM: 165090
• HGNC: 10447
• e!Ensembl: ENSG00000126458

Protein

• UniProt ID: P10301
• Protein name: Ras-related protein R-Ras (EC 3.6.5.2) (p23)
• Protein function: GTP-binding protein with GTPase activity, likely involved in the regulation of MAPK signaling pathway and thereby controlling multiple cellular processes (PubMed:39809765). Regulates the organization of the actin cytoskeleton (PubMed:16537651, P
• PDB: 2FN4, 7S0Z
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	31 → 192	Ras family	Domain

• Sequence:

  MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP
  TIEDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG
  KLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVD
  EAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL

• Sequence length: 218

Pathways

KEGG:

MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cAMP signaling pathway
Phospholipase D signaling pathway
Mitophagy - animal
Autophagy - animal
Cellular senescence
Axon guidance
Apelin signaling pathway
C-type lectin receptor signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Proteoglycans in cancer

Reactome:

Sema4D mediated inhibition of cell attachment and migration

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
DESBUQUOIS SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE MYELOMONOCYTIC LEUKEMIA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Noonan syndrome	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar ClinGen, Disgenet, GWAS catalog, Orphanet ClinGen, Disgenet, GWAS catalog, Orphanet ClinGen, Disgenet, GWAS catalog, Orphanet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
NOONAN SYNDROME AND NOONAN-RELATED SYNDROME	—	Disgenet Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RRAS-related disorder	Likely benign; Conflicting classifications of pathogenicity; Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abnormal dermatoglyphic pattern	Abnormal dermatoglyphic pattern	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	25248926		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27880046		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16530936		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	17089045		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	25241147		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	20826259		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30565243		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28487945		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	21390152		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	21390152	Associate	★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12386818, 18374156, 20847343, 22074947, 22677230, 24106833, 24700169, 30158566, 7612899		★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28167572	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	14621192		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	19011236	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28595131		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	28167572	Associate	★☆☆☆☆ Found in Text Mining only
Cardio-facio-cutaneous syndrome	Cardiofaciocutaneous syndrome	CLINGEN_DG			★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	16862428, 24439224		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	16862428, 24439224		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22677230		★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	BEFREE	21390152		★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	Pubtator	21390152	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	11444477		★☆☆☆☆ Found in Text Mining only
Clinodactyly of the 5th finger	Camptodactyly of fingers	HPO_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31393067		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27270312	Associate	★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	21390152		★☆☆☆☆ Found in Text Mining only
Congenital pectus carinatum	Congenital Pectus Carinatum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Costello syndrome (disorder)	Costello syndrome	CLINGEN_DG			★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31785770		★☆☆☆☆ Found in Text Mining only
Developmental reading disorder	Developmental dyslexia	BEFREE	19277710		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20592051, 31830958		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	24284398, 31217360		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20218740	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	12377406		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	30307755		★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	14621192		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	3313005		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	14621192		★☆☆☆☆ Found in Text Mining only
Gemistocytic astrocytoma	Gemistocytic Astrocytoma	BEFREE	25192052		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25192052		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	23209424		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	19011236	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27618447		★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Isodicentric Chromosome 15 Syndrome	Isodicentric Chromosome 15 Syndrome	BEFREE	12673638		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	24705357		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	ORPHANET_DG	24705357		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Juvenile myelomonocytic leukemia	Myelomonocytic Leukemia	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	CTD_human_DG	26457647		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEOPARD Syndrome	LEOPARD Syndrome	CLINGEN_DG			★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	30565243		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12034535, 16990778, 24705357, 8500100		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	39326641	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphangioma, Cystic	Cystic hygroma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12386818, 12771940, 18374156, 20847343, 22074947, 22677230, 24106833, 24700169, 30158566, 7612899		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28595131		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12377406, 15033445, 22899854, 25241147		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15781621		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23355466, 23382236, 24700169, 24746703, 25041015, 27659550, 28450422, 28610953, 30204910, 31257629		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	16862428, 24439224		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16809759, 20847343, 6207764		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16914723		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20585650	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23284172, 26993606		★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	1840564		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22487779		★☆☆☆☆ Found in Text Mining only
Neck webbing	Neck Webbing	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12377406, 12548599, 15033445, 15949565, 16314303, 16809759, 16862428, 18374156, 22074947, 22487779, 23604529, 24106833, 2457438, 26993606		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	15977987, 21691801		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	34530870	Associate	★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan Syndrome	CLINGEN_DG	23875798, 24705357		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Noonan Syndrome	Noonan Syndrome	BEFREE	24705357		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Noonan Syndrome	Noonan Syndrome	ORPHANET_DG	24705357		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Noonan syndrome	Noonan Syndrome	Orphanet			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Noonan syndrome-like disorder with loose anagen hair	Noonan-Like Syndrome With Loose Anagen Hair	CLINGEN_DG			★☆☆☆☆ Found in Text Mining only
Noonan-Like Syndrome With Loose Anagen Hair	Noonan-Like Syndrome With Loose Anagen Hair	CLINGEN_DG			★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22880127		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	14621192		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29471019		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12377406, 15033445, 22899854, 25241147		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18024597	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Radioulnar Synostosis	Radioulnar Synostosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	23900261		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	31785770		★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16530936		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25041015		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15781621		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34584127	Associate	★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	39326641	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	14621192		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	14621192		★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	19011236	Associate	★☆☆☆☆ Found in Text Mining only