Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6236
Gene name	RRAD, Ras related glycolysis inhibitor and calcium channel regulator
Gene symbol	RRAD
Synonyms (NCBI Gene)	RADRAD1REM3
Chromosome	16
Chromosome location	16q22.1

184

Show/Hide all (184)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019175	hsa-miR-335-5p	Microarray	18185580
MIRT454678	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT454677	hsa-miR-764	HITS-CLIP	23824327
MIRT454676	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT672981	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT672980	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT672979	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT672978	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT672977	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT672976	hsa-miR-4454	HITS-CLIP	23824327
MIRT672975	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT618586	hsa-miR-129-1-3p	HITS-CLIP	23824327
MIRT618585	hsa-miR-129-2-3p	HITS-CLIP	23824327
MIRT618584	hsa-miR-6854-5p	HITS-CLIP	23824327
MIRT618583	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT618582	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT618581	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT618580	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT618579	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT618578	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT618577	hsa-miR-7977	HITS-CLIP	23824327
MIRT618576	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT618575	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT618574	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT618573	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT618572	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT618571	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT618570	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT618569	hsa-miR-3689c	HITS-CLIP	23824327
MIRT618568	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT618567	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT618566	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT618565	hsa-miR-3122	HITS-CLIP	23824327
MIRT618564	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT618563	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT618562	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT618586	hsa-miR-129-1-3p	HITS-CLIP	23824327
MIRT618585	hsa-miR-129-2-3p	HITS-CLIP	23824327
MIRT618584	hsa-miR-6854-5p	HITS-CLIP	23824327
MIRT618583	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT618582	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT618581	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT618580	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT618579	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT618578	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT618577	hsa-miR-7977	HITS-CLIP	23824327
MIRT618576	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT618575	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT618574	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT618573	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT618572	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT618571	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT618570	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT618569	hsa-miR-3689c	HITS-CLIP	23824327
MIRT618568	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT618567	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT618566	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT618565	hsa-miR-3122	HITS-CLIP	23824327
MIRT618564	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT618563	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT618562	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT527770	hsa-miR-6782-5p	PAR-CLIP	22012620
MIRT527755	hsa-miR-411-5p	PAR-CLIP	22012620
MIRT527769	hsa-miR-500b-3p	PAR-CLIP	22012620
MIRT527768	hsa-miR-4735-5p	PAR-CLIP	22012620
MIRT527767	hsa-let-7a-5p	PAR-CLIP	22012620
MIRT527766	hsa-let-7b-5p	PAR-CLIP	22012620
MIRT527765	hsa-let-7c-5p	PAR-CLIP	22012620
MIRT527764	hsa-let-7d-5p	PAR-CLIP	22012620
MIRT527763	hsa-let-7e-5p	PAR-CLIP	22012620
MIRT527762	hsa-let-7f-5p	PAR-CLIP	22012620
MIRT527761	hsa-let-7g-5p	PAR-CLIP	22012620
MIRT527760	hsa-let-7i-5p	PAR-CLIP	22012620
MIRT527759	hsa-miR-4458	PAR-CLIP	22012620
MIRT527758	hsa-miR-4500	PAR-CLIP	22012620
MIRT527757	hsa-miR-98-5p	PAR-CLIP	22012620
MIRT527756	hsa-miR-193b-5p	PAR-CLIP	22012620
MIRT527755	hsa-miR-411-5p	PAR-CLIP	22012620
MIRT527754	hsa-miR-197-3p	PAR-CLIP	22012620
MIRT527753	hsa-miR-3149	PAR-CLIP	22012620
MIRT527752	hsa-miR-5096	PAR-CLIP	22012620
MIRT454680	hsa-miR-4475	PAR-CLIP	23592263
MIRT454679	hsa-miR-7845-5p	PAR-CLIP	23592263
MIRT454678	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT454677	hsa-miR-764	PAR-CLIP	23592263
MIRT454676	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT454675	hsa-miR-4450	PAR-CLIP	23592263
MIRT454674	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT454673	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT454672	hsa-miR-6892-5p	PAR-CLIP	23592263
MIRT454671	hsa-miR-6857-5p	PAR-CLIP	23592263
MIRT454678	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT454677	hsa-miR-764	HITS-CLIP	23824327
MIRT454676	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT672981	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT672980	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT672979	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT672978	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT672977	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT672976	hsa-miR-4454	HITS-CLIP	23824327
MIRT672975	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT618586	hsa-miR-129-1-3p	HITS-CLIP	23824327
MIRT618585	hsa-miR-129-2-3p	HITS-CLIP	23824327
MIRT618584	hsa-miR-6854-5p	HITS-CLIP	23824327
MIRT618583	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT618582	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT618581	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT618580	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT618579	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT618578	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT618577	hsa-miR-7977	HITS-CLIP	23824327
MIRT618576	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT618575	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT618574	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT618573	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT618572	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT618571	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT618570	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT618569	hsa-miR-3689c	HITS-CLIP	23824327
MIRT618568	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT618567	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT618566	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT618565	hsa-miR-3122	HITS-CLIP	23824327
MIRT618564	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT618563	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT618562	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT618586	hsa-miR-129-1-3p	HITS-CLIP	23824327
MIRT618585	hsa-miR-129-2-3p	HITS-CLIP	23824327
MIRT618584	hsa-miR-6854-5p	HITS-CLIP	23824327
MIRT618583	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT618582	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT618581	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT618580	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT618579	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT618578	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT618577	hsa-miR-7977	HITS-CLIP	23824327
MIRT618576	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT618575	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT618574	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT618573	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT618572	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT618571	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT618570	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT618569	hsa-miR-3689c	HITS-CLIP	23824327
MIRT618568	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT618567	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT618566	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT618565	hsa-miR-3122	HITS-CLIP	23824327
MIRT618564	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT618563	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT618562	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT527770	hsa-miR-6782-5p	PAR-CLIP	22012620
MIRT527755	hsa-miR-411-5p	PAR-CLIP	22012620
MIRT527769	hsa-miR-500b-3p	PAR-CLIP	22012620
MIRT527768	hsa-miR-4735-5p	PAR-CLIP	22012620
MIRT527767	hsa-let-7a-5p	PAR-CLIP	22012620
MIRT527766	hsa-let-7b-5p	PAR-CLIP	22012620
MIRT527765	hsa-let-7c-5p	PAR-CLIP	22012620
MIRT527764	hsa-let-7d-5p	PAR-CLIP	22012620
MIRT527763	hsa-let-7e-5p	PAR-CLIP	22012620
MIRT527762	hsa-let-7f-5p	PAR-CLIP	22012620
MIRT527761	hsa-let-7g-5p	PAR-CLIP	22012620
MIRT527760	hsa-let-7i-5p	PAR-CLIP	22012620
MIRT527759	hsa-miR-4458	PAR-CLIP	22012620
MIRT527758	hsa-miR-4500	PAR-CLIP	22012620
MIRT527757	hsa-miR-98-5p	PAR-CLIP	22012620
MIRT527756	hsa-miR-193b-5p	PAR-CLIP	22012620
MIRT527755	hsa-miR-411-5p	PAR-CLIP	22012620
MIRT527754	hsa-miR-197-3p	PAR-CLIP	22012620
MIRT527753	hsa-miR-3149	PAR-CLIP	22012620
MIRT527752	hsa-miR-5096	PAR-CLIP	22012620
MIRT454680	hsa-miR-4475	PAR-CLIP	23592263
MIRT454679	hsa-miR-7845-5p	PAR-CLIP	23592263
MIRT454678	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT454677	hsa-miR-764	PAR-CLIP	23592263
MIRT454676	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT454675	hsa-miR-4450	PAR-CLIP	23592263
MIRT454674	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT454673	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT454672	hsa-miR-6892-5p	PAR-CLIP	23592263
MIRT454671	hsa-miR-6857-5p	PAR-CLIP	23592263
MIRT1319315	hsa-miR-3614-3p	CLIP-seq
MIRT1319316	hsa-miR-556-3p	CLIP-seq
MIRT1319317	hsa-miR-873	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS	8248782
GO:0005246	Function	Calcium channel regulator activity	IBA
GO:0005515	Function	Protein binding	IPI	10359610, 20460530
GO:0005516	Function	Calmodulin binding	IEA
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	TAS	8248782
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
179503	10446	ENSG00000166592

P55042

Protein name

GTP-binding protein RAD (RAD1) (Ras associated with diabetes)

Protein function

May regulate basal voltage-dependent L-type Ca(2+) currents and be required for beta-adrenergic augmentation of Ca(2+) influx in cardiomyocytes, thereby regulating increases in heart rate and contractile force (By similarity). May play an import

PDB

2DPX , 2GJS , 3Q72 , 3Q7P , 3Q7Q

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	93 → 253	Ras family	Domain

Tissue specificity

TISSUE SPECIFICITY: Most abundantly expressed in the heart. Also found in the skeletal muscle and lung. Lesser amounts in placenta and kidney. Also detected in adipose tissue. Overexpressed in muscle of type II diabetic humans. {ECO:0000269|PubMed:1805652

Sequence

MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAA
AGTGTQGPRLDWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEA
EAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKA
SELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNV
QALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKRFLGRIVARNSRKMAFRAKSK
SCHDLSVL

Sequence length

308

Interactions

View interactions

	Reactome
			NGF-stimulated transcription

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRUGADA SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (70)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	24222170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	17195088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	31309259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	20079427, 26490867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10463575, 17195088, 24894645, 25520248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	17195088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brugada Syndrome	Brugada syndrome	Pubtator	31114854	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brugada Syndrome (disorder)	Brugada Syndrome	BEFREE	31114854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28541631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26546438	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25114038, 28254357, 31839825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37839873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30223012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	19301259, 19475568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	20842178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27798760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29127877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10024077, 8603763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10024077, 8603763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	16866878, 8810259	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	16511212, 16866878, 7876254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10024077, 7859947, 8603763, 9059762		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31309259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	26344687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24222170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24222170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	39891186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	24222170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25313011, 27296952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26506879	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25313011, 27296952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	LHGDN	17525370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27798760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	27782108	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29451048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25114038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	24862967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26546438, 30881024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	26546438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25114038, 25893381	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37839873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	31309259, 31836849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10463575, 17195088, 24894645, 25520248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	17195088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24222170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25114038, 28254357, 31839825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28656462, 29859119, 31473884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11248061, 26546438, 30881024, 31839825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	17195088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	17195088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	17195088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	19723646, 23466598, 31309259, 31836849		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29666297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	26546438	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	26490867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30223012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	31697570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22487779, 28716111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11290553, 22487779, 24451080, 24648519, 25313011, 28029651, 3045425, 30881024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17195088, 24445599, 28029651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	17195088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28591191, 34837690	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	11290553	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28656462, 29859119, 31473884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	15184880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24222170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	30223012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	30223012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18559093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum, group F	Xeroderma Pigmentosum	BEFREE	8797827		★★★★★ ★☆☆☆☆ Found in Text Mining only

RRAD (RRAD, Ras related glycolysis inhibitor and calcium channel regulator)