Gene Gene information from NCBI Gene database.
Entrez ID 6236
Gene name RRAD, Ras related glycolysis inhibitor and calcium channel regulator
Gene symbol RRAD
Synonyms (NCBI Gene)
RADRAD1REM3
Chromosome 16
Chromosome location 16q22.1
miRNA miRNA information provided by mirtarbase database.
184
miRTarBase ID miRNA Experiments Reference
MIRT019175 hsa-miR-335-5p Microarray 18185580
MIRT454678 hsa-miR-125a-3p HITS-CLIP 23824327
MIRT454677 hsa-miR-764 HITS-CLIP 23824327
MIRT454676 hsa-miR-3934-5p HITS-CLIP 23824327
MIRT672981 hsa-miR-1224-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0003924 Function GTPase activity IEA
GO:0003924 Function GTPase activity TAS 8248782
GO:0005246 Function Calcium channel regulator activity IBA
GO:0005515 Function Protein binding IPI 10359610, 20460530
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
179503 10446 ENSG00000166592
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P55042
Protein name GTP-binding protein RAD (RAD1) (Ras associated with diabetes)
Protein function May regulate basal voltage-dependent L-type Ca(2+) currents and be required for beta-adrenergic augmentation of Ca(2+) influx in cardiomyocytes, thereby regulating increases in heart rate and contractile force (By similarity). May play an import
PDB 2DPX , 2GJS , 3Q72 , 3Q7P , 3Q7Q
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00071 Ras 93 253 Ras family Domain
Tissue specificity TISSUE SPECIFICITY: Most abundantly expressed in the heart. Also found in the skeletal muscle and lung. Lesser amounts in placenta and kidney. Also detected in adipose tissue. Overexpressed in muscle of type II diabetic humans. {ECO:0000269|PubMed:1805652
Sequence
MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAA
AGTGTQGPRLDWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEA
EAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKA
SELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNV
QALFEGVVRQIRL
RRDSKEANARRQAGTRRRESLGKKAKRFLGRIVARNSRKMAFRAKSK
SCHDLSVL
Sequence length 308
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    NGF-stimulated transcription
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
5
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BREAST NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BRUGADA SYNDROME Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Of Esophagus Esophageal Cancer BEFREE 24222170
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 17195088
★☆☆☆☆
Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma B-cell Lymphoma BEFREE 31309259
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis BEFREE 20079427, 26490867
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 10463575, 17195088, 24894645, 25520248
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma CTD_human_DG 17195088
★☆☆☆☆
Found in Text Mining only
Brugada Syndrome Brugada syndrome Pubtator 31114854 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Brugada Syndrome (disorder) Brugada Syndrome BEFREE 31114854
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 28541631
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 26546438 Inhibit
★☆☆☆☆
Found in Text Mining only