RPS6KA2 (ribosomal protein S6 kinase A2)

Gene

• Entrez ID: 6196
• Gene name: Ribosomal protein S6 kinase A2
• Gene symbol: RPS6KA2
• Synonyms (NCBI Gene): HU-2, MAPKAPK1C, RSK, RSK3, S6K-alpha, S6K-alpha2, p90-RSK3, p90RSK2, pp90RSK3
• Chromosome: 6
• Chromosome location: 6q27
• Summary: This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains two non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK)

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018582	hsa-miR-335-5p	Microarray	18185580
MIRT496979	hsa-miR-370-5p	PAR-CLIP	22291592
MIRT496978	hsa-miR-5587-3p	PAR-CLIP	22291592
MIRT496977	hsa-miR-1247-3p	PAR-CLIP	22291592
MIRT496976	hsa-miR-1225-3p	PAR-CLIP	22291592
MIRT496975	hsa-miR-4755-3p	PAR-CLIP	22291592
MIRT496974	hsa-miR-6827-5p	PAR-CLIP	22291592
MIRT496973	hsa-miR-3175	PAR-CLIP	22291592
MIRT496972	hsa-miR-1343-5p	PAR-CLIP	22291592
MIRT496971	hsa-miR-939-5p	PAR-CLIP	22291592
MIRT496970	hsa-miR-6825-5p	PAR-CLIP	22291592
MIRT496969	hsa-miR-5006-5p	PAR-CLIP	22291592
MIRT496968	hsa-miR-3150a-3p	PAR-CLIP	22291592
MIRT496967	hsa-miR-6763-5p	PAR-CLIP	22291592
MIRT496979	hsa-miR-370-5p	PAR-CLIP	22291592
MIRT496978	hsa-miR-5587-3p	PAR-CLIP	22291592
MIRT496977	hsa-miR-1247-3p	PAR-CLIP	22291592
MIRT496976	hsa-miR-1225-3p	PAR-CLIP	22291592
MIRT496975	hsa-miR-4755-3p	PAR-CLIP	22291592
MIRT496974	hsa-miR-6827-5p	PAR-CLIP	22291592
MIRT496973	hsa-miR-3175	PAR-CLIP	22291592
MIRT496972	hsa-miR-1343-5p	PAR-CLIP	22291592
MIRT496971	hsa-miR-939-5p	PAR-CLIP	22291592
MIRT496970	hsa-miR-6825-5p	PAR-CLIP	22291592
MIRT496969	hsa-miR-5006-5p	PAR-CLIP	22291592
MIRT496968	hsa-miR-3150a-3p	PAR-CLIP	22291592
MIRT496967	hsa-miR-6763-5p	PAR-CLIP	22291592
MIRT1318043	hsa-miR-106a	CLIP-seq
MIRT1318044	hsa-miR-106b	CLIP-seq
MIRT1318045	hsa-miR-1294	CLIP-seq
MIRT1318046	hsa-miR-1298	CLIP-seq
MIRT1318047	hsa-miR-17	CLIP-seq
MIRT1318048	hsa-miR-1827	CLIP-seq
MIRT1318049	hsa-miR-19a	CLIP-seq
MIRT1318050	hsa-miR-19b	CLIP-seq
MIRT1318051	hsa-miR-20a	CLIP-seq
MIRT1318052	hsa-miR-20b	CLIP-seq
MIRT1318053	hsa-miR-2110	CLIP-seq
MIRT1318054	hsa-miR-2113	CLIP-seq
MIRT1318055	hsa-miR-302a	CLIP-seq
MIRT1318056	hsa-miR-302b	CLIP-seq
MIRT1318057	hsa-miR-302c	CLIP-seq
MIRT1318058	hsa-miR-302d	CLIP-seq
MIRT1318059	hsa-miR-302e	CLIP-seq
MIRT1318060	hsa-miR-3173-3p	CLIP-seq
MIRT1318061	hsa-miR-372	CLIP-seq
MIRT1318062	hsa-miR-373	CLIP-seq
MIRT1318063	hsa-miR-3919	CLIP-seq
MIRT1318064	hsa-miR-3942-3p	CLIP-seq
MIRT1318065	hsa-miR-4260	CLIP-seq
MIRT1318066	hsa-miR-4316	CLIP-seq
MIRT1318067	hsa-miR-4428	CLIP-seq
MIRT1318068	hsa-miR-4433	CLIP-seq
MIRT1318069	hsa-miR-4434	CLIP-seq
MIRT1318070	hsa-miR-4459	CLIP-seq
MIRT1318071	hsa-miR-4516	CLIP-seq
MIRT1318072	hsa-miR-4521	CLIP-seq
MIRT1318073	hsa-miR-4531	CLIP-seq
MIRT1318074	hsa-miR-4653-3p	CLIP-seq
MIRT1318075	hsa-miR-4663	CLIP-seq
MIRT1318076	hsa-miR-4676-5p	CLIP-seq
MIRT1318077	hsa-miR-4768-3p	CLIP-seq
MIRT1318078	hsa-miR-4802-5p	CLIP-seq
MIRT1318079	hsa-miR-487a	CLIP-seq
MIRT1318080	hsa-miR-512-3p	CLIP-seq
MIRT1318081	hsa-miR-518a-5p	CLIP-seq
MIRT1318082	hsa-miR-519d	CLIP-seq
MIRT1318083	hsa-miR-520a-3p	CLIP-seq
MIRT1318084	hsa-miR-520b	CLIP-seq
MIRT1318085	hsa-miR-520c-3p	CLIP-seq
MIRT1318086	hsa-miR-520d-3p	CLIP-seq
MIRT1318087	hsa-miR-520e	CLIP-seq
MIRT1318088	hsa-miR-520g	CLIP-seq
MIRT1318089	hsa-miR-520h	CLIP-seq
MIRT1318090	hsa-miR-527	CLIP-seq
MIRT1318091	hsa-miR-548c-3p	CLIP-seq
MIRT1318092	hsa-miR-570	CLIP-seq
MIRT1318093	hsa-miR-575	CLIP-seq
MIRT1318094	hsa-miR-579	CLIP-seq
MIRT1318095	hsa-miR-589	CLIP-seq
MIRT1318096	hsa-miR-616	CLIP-seq
MIRT1318097	hsa-miR-93	CLIP-seq
MIRT1318098	hsa-miR-939	CLIP-seq
MIRT1318099	hsa-miR-1184	CLIP-seq
MIRT1318100	hsa-miR-1206	CLIP-seq
MIRT1318048	hsa-miR-1827	CLIP-seq
MIRT1318101	hsa-miR-199a-3p	CLIP-seq
MIRT1318102	hsa-miR-199b-3p	CLIP-seq
MIRT1318103	hsa-miR-204	CLIP-seq
MIRT1318104	hsa-miR-211	CLIP-seq
MIRT1318105	hsa-miR-3129-5p	CLIP-seq
MIRT1318106	hsa-miR-361-3p	CLIP-seq
MIRT1318107	hsa-miR-3679-3p	CLIP-seq
MIRT1318108	hsa-miR-375	CLIP-seq
MIRT1318063	hsa-miR-3919	CLIP-seq
MIRT1318109	hsa-miR-4286	CLIP-seq
MIRT1318110	hsa-miR-4314	CLIP-seq
MIRT1318111	hsa-miR-4421	CLIP-seq
MIRT1318068	hsa-miR-4433	CLIP-seq
MIRT1318112	hsa-miR-4446-5p	CLIP-seq
MIRT1318070	hsa-miR-4459	CLIP-seq
MIRT1318113	hsa-miR-4695-3p	CLIP-seq
MIRT1318114	hsa-miR-4755-5p	CLIP-seq
MIRT1318077	hsa-miR-4768-3p	CLIP-seq
MIRT1318115	hsa-miR-4797-3p	CLIP-seq
MIRT1318094	hsa-miR-579	CLIP-seq
MIRT1318116	hsa-miR-623	CLIP-seq
MIRT1318117	hsa-miR-936	CLIP-seq
MIRT2094509	hsa-miR-1307	CLIP-seq
MIRT2094510	hsa-miR-199a-5p	CLIP-seq
MIRT2094511	hsa-miR-199b-5p	CLIP-seq
MIRT2094512	hsa-miR-296-3p	CLIP-seq
MIRT2094513	hsa-miR-3615	CLIP-seq
MIRT2094514	hsa-miR-3689a-3p	CLIP-seq
MIRT2094515	hsa-miR-3689c	CLIP-seq
MIRT2094516	hsa-miR-3918	CLIP-seq
MIRT2094517	hsa-miR-3926	CLIP-seq
MIRT2094518	hsa-miR-4252	CLIP-seq
MIRT2094519	hsa-miR-4255	CLIP-seq
MIRT2094520	hsa-miR-4293	CLIP-seq
MIRT1318066	hsa-miR-4316	CLIP-seq
MIRT2094521	hsa-miR-4324	CLIP-seq
MIRT2094522	hsa-miR-4435	CLIP-seq
MIRT2094523	hsa-miR-4638-5p	CLIP-seq
MIRT1318076	hsa-miR-4676-5p	CLIP-seq
MIRT2094524	hsa-miR-4786-3p	CLIP-seq
MIRT1318081	hsa-miR-518a-5p	CLIP-seq
MIRT1318090	hsa-miR-527	CLIP-seq
MIRT1318092	hsa-miR-570	CLIP-seq
MIRT1318093	hsa-miR-575	CLIP-seq
MIRT2094525	hsa-miR-671-5p	CLIP-seq
MIRT2094526	hsa-miR-873	CLIP-seq
MIRT1318043	hsa-miR-106a	CLIP-seq
MIRT1318044	hsa-miR-106b	CLIP-seq
MIRT2319011	hsa-miR-1207-3p	CLIP-seq
MIRT2319012	hsa-miR-1253	CLIP-seq
MIRT2319013	hsa-miR-1269	CLIP-seq
MIRT2319014	hsa-miR-1269b	CLIP-seq
MIRT2319015	hsa-miR-1288	CLIP-seq
MIRT2094509	hsa-miR-1307	CLIP-seq
MIRT2319016	hsa-miR-150	CLIP-seq
MIRT1318047	hsa-miR-17	CLIP-seq
MIRT1318048	hsa-miR-1827	CLIP-seq
MIRT1318051	hsa-miR-20a	CLIP-seq
MIRT1318052	hsa-miR-20b	CLIP-seq
MIRT1318055	hsa-miR-302a	CLIP-seq
MIRT1318056	hsa-miR-302b	CLIP-seq
MIRT1318057	hsa-miR-302c	CLIP-seq
MIRT1318058	hsa-miR-302d	CLIP-seq
MIRT1318059	hsa-miR-302e	CLIP-seq
MIRT2319017	hsa-miR-30a	CLIP-seq
MIRT2319018	hsa-miR-30b	CLIP-seq
MIRT2319019	hsa-miR-30c	CLIP-seq
MIRT2319020	hsa-miR-30d	CLIP-seq
MIRT2319021	hsa-miR-30e	CLIP-seq
MIRT2319022	hsa-miR-3122	CLIP-seq
MIRT2319023	hsa-miR-3156-3p	CLIP-seq
MIRT2319024	hsa-miR-330-3p	CLIP-seq
MIRT2319025	hsa-miR-3612	CLIP-seq
MIRT2094513	hsa-miR-3615	CLIP-seq
MIRT2319026	hsa-miR-3662	CLIP-seq
MIRT1318061	hsa-miR-372	CLIP-seq
MIRT1318062	hsa-miR-373	CLIP-seq
MIRT2319027	hsa-miR-378	CLIP-seq
MIRT2319028	hsa-miR-378b	CLIP-seq
MIRT2319029	hsa-miR-378c	CLIP-seq
MIRT2319030	hsa-miR-378d	CLIP-seq
MIRT2319031	hsa-miR-378e	CLIP-seq
MIRT2319032	hsa-miR-378f	CLIP-seq
MIRT2319033	hsa-miR-378h	CLIP-seq
MIRT2319034	hsa-miR-378i	CLIP-seq
MIRT2319035	hsa-miR-3913-5p	CLIP-seq
MIRT2319036	hsa-miR-422a	CLIP-seq
MIRT2319037	hsa-miR-4251	CLIP-seq
MIRT2319038	hsa-miR-4266	CLIP-seq
MIRT2319039	hsa-miR-4267	CLIP-seq
MIRT2319040	hsa-miR-4291	CLIP-seq
MIRT2319041	hsa-miR-4301	CLIP-seq
MIRT2319042	hsa-miR-4418	CLIP-seq
MIRT2319043	hsa-miR-4464	CLIP-seq
MIRT2319044	hsa-miR-450b-3p	CLIP-seq
MIRT2319045	hsa-miR-4515	CLIP-seq
MIRT2094523	hsa-miR-4638-5p	CLIP-seq
MIRT1318075	hsa-miR-4663	CLIP-seq
MIRT1318076	hsa-miR-4676-5p	CLIP-seq
MIRT2319046	hsa-miR-4695-5p	CLIP-seq
MIRT2319047	hsa-miR-4713-5p	CLIP-seq
MIRT2319048	hsa-miR-4740-5p	CLIP-seq
MIRT2319049	hsa-miR-4747-5p	CLIP-seq
MIRT2319050	hsa-miR-4748	CLIP-seq
MIRT2319051	hsa-miR-4779	CLIP-seq
MIRT2319052	hsa-miR-4803	CLIP-seq
MIRT2319053	hsa-miR-509-3-5p	CLIP-seq
MIRT2319054	hsa-miR-509-5p	CLIP-seq
MIRT1318080	hsa-miR-512-3p	CLIP-seq
MIRT2319055	hsa-miR-518a-3p	CLIP-seq
MIRT2319056	hsa-miR-518b	CLIP-seq
MIRT2319057	hsa-miR-518c	CLIP-seq
MIRT2319058	hsa-miR-518d-3p	CLIP-seq
MIRT2319059	hsa-miR-518f	CLIP-seq
MIRT1318082	hsa-miR-519d	CLIP-seq
MIRT1318083	hsa-miR-520a-3p	CLIP-seq
MIRT1318084	hsa-miR-520b	CLIP-seq
MIRT1318085	hsa-miR-520c-3p	CLIP-seq
MIRT1318086	hsa-miR-520d-3p	CLIP-seq
MIRT2319060	hsa-miR-520d-5p	CLIP-seq
MIRT1318087	hsa-miR-520e	CLIP-seq
MIRT1318088	hsa-miR-520g	CLIP-seq
MIRT1318089	hsa-miR-520h	CLIP-seq
MIRT2319061	hsa-miR-524-5p	CLIP-seq
MIRT2319062	hsa-miR-532-3p	CLIP-seq
MIRT2319063	hsa-miR-545	CLIP-seq
MIRT2319064	hsa-miR-548m	CLIP-seq
MIRT2319065	hsa-miR-548p	CLIP-seq
MIRT1318092	hsa-miR-570	CLIP-seq
MIRT1318093	hsa-miR-575	CLIP-seq
MIRT1318094	hsa-miR-579	CLIP-seq
MIRT2319066	hsa-miR-650	CLIP-seq
MIRT2094525	hsa-miR-671-5p	CLIP-seq
MIRT2319067	hsa-miR-766	CLIP-seq
MIRT2319068	hsa-miR-769-3p	CLIP-seq
MIRT2094526	hsa-miR-873	CLIP-seq
MIRT1318097	hsa-miR-93	CLIP-seq
MIRT2094509	hsa-miR-1307	CLIP-seq
MIRT2094513	hsa-miR-3615	CLIP-seq
MIRT2094523	hsa-miR-4638-5p	CLIP-seq
MIRT1318092	hsa-miR-570	CLIP-seq
MIRT2432833	hsa-miR-3609	CLIP-seq
MIRT2432834	hsa-miR-3610	CLIP-seq
MIRT2432835	hsa-miR-548ah	CLIP-seq
MIRT2432836	hsa-miR-548n	CLIP-seq
MIRT2432837	hsa-miR-548t	CLIP-seq
MIRT2094510	hsa-miR-199a-5p	CLIP-seq
MIRT2094511	hsa-miR-199b-5p	CLIP-seq
MIRT2439978	hsa-miR-2117	CLIP-seq
MIRT2094516	hsa-miR-3918	CLIP-seq
MIRT2094519	hsa-miR-4255	CLIP-seq
MIRT2439979	hsa-miR-4273	CLIP-seq
MIRT1318076	hsa-miR-4676-5p	CLIP-seq
MIRT2439980	hsa-miR-512-5p	CLIP-seq
MIRT1318093	hsa-miR-575	CLIP-seq
MIRT2458598	hsa-miR-1270	CLIP-seq
MIRT2458599	hsa-miR-2467-5p	CLIP-seq
MIRT2458600	hsa-miR-3188	CLIP-seq
MIRT1318106	hsa-miR-361-3p	CLIP-seq
MIRT2458601	hsa-miR-3943	CLIP-seq
MIRT2458602	hsa-miR-3975	CLIP-seq
MIRT1318066	hsa-miR-4316	CLIP-seq
MIRT2458603	hsa-miR-432	CLIP-seq
MIRT1318069	hsa-miR-4434	CLIP-seq
MIRT1318071	hsa-miR-4516	CLIP-seq
MIRT1318073	hsa-miR-4531	CLIP-seq
MIRT2458604	hsa-miR-4726-3p	CLIP-seq
MIRT2458605	hsa-miR-485-5p	CLIP-seq
MIRT2458606	hsa-miR-620	CLIP-seq
MIRT2458598	hsa-miR-1270	CLIP-seq
MIRT2458599	hsa-miR-2467-5p	CLIP-seq
MIRT2458600	hsa-miR-3188	CLIP-seq
MIRT1318106	hsa-miR-361-3p	CLIP-seq
MIRT2458601	hsa-miR-3943	CLIP-seq
MIRT2458602	hsa-miR-3975	CLIP-seq
MIRT1318066	hsa-miR-4316	CLIP-seq
MIRT2458603	hsa-miR-432	CLIP-seq
MIRT1318069	hsa-miR-4434	CLIP-seq
MIRT1318071	hsa-miR-4516	CLIP-seq
MIRT1318073	hsa-miR-4531	CLIP-seq
MIRT2458604	hsa-miR-4726-3p	CLIP-seq
MIRT2458605	hsa-miR-485-5p	CLIP-seq
MIRT2458606	hsa-miR-620	CLIP-seq
MIRT2614716	hsa-miR-1204	CLIP-seq
MIRT2614717	hsa-miR-138	CLIP-seq
MIRT2614718	hsa-miR-1537	CLIP-seq
MIRT2094510	hsa-miR-199a-5p	CLIP-seq
MIRT2094511	hsa-miR-199b-5p	CLIP-seq
MIRT2439978	hsa-miR-2117	CLIP-seq
MIRT2614719	hsa-miR-3127-3p	CLIP-seq
MIRT2614720	hsa-miR-3160-3p	CLIP-seq
MIRT1318060	hsa-miR-3173-3p	CLIP-seq
MIRT2614721	hsa-miR-3183	CLIP-seq
MIRT2614722	hsa-miR-3189-5p	CLIP-seq
MIRT2614723	hsa-miR-3667-3p	CLIP-seq
MIRT2614724	hsa-miR-3671	CLIP-seq
MIRT2094516	hsa-miR-3918	CLIP-seq
MIRT2094519	hsa-miR-4255	CLIP-seq
MIRT2439979	hsa-miR-4273	CLIP-seq
MIRT2614725	hsa-miR-4279	CLIP-seq
MIRT2614726	hsa-miR-4294	CLIP-seq
MIRT2614727	hsa-miR-4297	CLIP-seq
MIRT2614728	hsa-miR-4457	CLIP-seq
MIRT2614729	hsa-miR-4487	CLIP-seq
MIRT2614730	hsa-miR-4640-3p	CLIP-seq
MIRT2614731	hsa-miR-4666-5p	CLIP-seq
MIRT2614732	hsa-miR-4668-5p	CLIP-seq
MIRT1318076	hsa-miR-4676-5p	CLIP-seq
MIRT2614733	hsa-miR-4679	CLIP-seq
MIRT2614734	hsa-miR-4723-3p	CLIP-seq
MIRT2614735	hsa-miR-4731-3p	CLIP-seq
MIRT2614736	hsa-miR-4758-3p	CLIP-seq
MIRT2614737	hsa-miR-4763-5p	CLIP-seq
MIRT2319051	hsa-miR-4779	CLIP-seq
MIRT2614738	hsa-miR-4801	CLIP-seq
MIRT2439980	hsa-miR-512-5p	CLIP-seq
MIRT2614739	hsa-miR-548q	CLIP-seq
MIRT2614740	hsa-miR-556-5p	CLIP-seq
MIRT2614741	hsa-miR-558	CLIP-seq
MIRT1318092	hsa-miR-570	CLIP-seq
MIRT1318093	hsa-miR-575	CLIP-seq
MIRT2614742	hsa-miR-591	CLIP-seq
MIRT2614743	hsa-miR-596	CLIP-seq
MIRT2614744	hsa-miR-720	CLIP-seq
MIRT1318098	hsa-miR-939	CLIP-seq
MIRT2690024	hsa-miR-1229	CLIP-seq
MIRT2690025	hsa-miR-1271	CLIP-seq
MIRT2614717	hsa-miR-138	CLIP-seq
MIRT2690026	hsa-miR-182	CLIP-seq
MIRT2094510	hsa-miR-199a-5p	CLIP-seq
MIRT2094511	hsa-miR-199b-5p	CLIP-seq
MIRT1318103	hsa-miR-204	CLIP-seq
MIRT1318104	hsa-miR-211	CLIP-seq
MIRT2439978	hsa-miR-2117	CLIP-seq
MIRT2614719	hsa-miR-3127-3p	CLIP-seq
MIRT2614720	hsa-miR-3160-3p	CLIP-seq
MIRT1318060	hsa-miR-3173-3p	CLIP-seq
MIRT2614721	hsa-miR-3183	CLIP-seq
MIRT2614722	hsa-miR-3189-5p	CLIP-seq
MIRT1318106	hsa-miR-361-3p	CLIP-seq
MIRT2614723	hsa-miR-3667-3p	CLIP-seq
MIRT2614724	hsa-miR-3671	CLIP-seq
MIRT1318107	hsa-miR-3679-3p	CLIP-seq
MIRT2094516	hsa-miR-3918	CLIP-seq
MIRT2094519	hsa-miR-4255	CLIP-seq
MIRT2439979	hsa-miR-4273	CLIP-seq
MIRT2614725	hsa-miR-4279	CLIP-seq
MIRT1318109	hsa-miR-4286	CLIP-seq
MIRT2614726	hsa-miR-4294	CLIP-seq
MIRT2614727	hsa-miR-4297	CLIP-seq
MIRT2614728	hsa-miR-4457	CLIP-seq
MIRT2614729	hsa-miR-4487	CLIP-seq
MIRT2614730	hsa-miR-4640-3p	CLIP-seq
MIRT2614731	hsa-miR-4666-5p	CLIP-seq
MIRT1318076	hsa-miR-4676-5p	CLIP-seq
MIRT2614733	hsa-miR-4679	CLIP-seq
MIRT2614734	hsa-miR-4723-3p	CLIP-seq
MIRT2614735	hsa-miR-4731-3p	CLIP-seq
MIRT2690027	hsa-miR-4746-5p	CLIP-seq
MIRT2614736	hsa-miR-4758-3p	CLIP-seq
MIRT2614737	hsa-miR-4763-5p	CLIP-seq
MIRT2319051	hsa-miR-4779	CLIP-seq
MIRT2614738	hsa-miR-4801	CLIP-seq
MIRT2690028	hsa-miR-483-3p	CLIP-seq
MIRT2439980	hsa-miR-512-5p	CLIP-seq
MIRT2614739	hsa-miR-548q	CLIP-seq
MIRT2614740	hsa-miR-556-5p	CLIP-seq
MIRT2614741	hsa-miR-558	CLIP-seq
MIRT1318093	hsa-miR-575	CLIP-seq
MIRT2614742	hsa-miR-591	CLIP-seq
MIRT2614743	hsa-miR-596	CLIP-seq
MIRT2614744	hsa-miR-720	CLIP-seq
MIRT1318098	hsa-miR-939	CLIP-seq
MIRT2690029	hsa-miR-96	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IEA
GO:0001556	Process	Oocyte maturation	IEA
GO:0002035	Process	Brain renin-angiotensin system	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	7623830
GO:0004711	Function	Ribosomal protein S6 kinase activity	IBA
GO:0004711	Function	Ribosomal protein S6 kinase activity	IEA
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IDA	22797923
GO:0005515	Function	Protein binding	IPI	16810323, 21988832, 23602568, 25852190, 29144123, 30126976, 32296183, 32707033, 32814053, 33961781, 34591642, 35271311, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	16878154
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	7623830
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16878154
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	NAS	7623830
GO:0007268	Process	Chemical synaptic transmission	TAS
GO:0007507	Process	Heart development	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	16878154
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010659	Process	Cardiac muscle cell apoptotic process	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	TAS	7623830, 8141249
GO:0038202	Process	TORC1 signaling	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	16878154
GO:0045202	Component	Synapse	IEA
GO:0045786	Process	Negative regulation of cell cycle	IDA	16878154
GO:0045835	Process	Negative regulation of meiotic nuclear division	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060047	Process	Heart contraction	IEA
GO:0070613	Process	Regulation of protein processing	IEA
GO:0071322	Process	Cellular response to carbohydrate stimulus	IEA
GO:0072687	Component	Meiotic spindle	IEA
GO:0106310	Function	Protein serine kinase activity	IEA

Other IDs

• MIM: 601685
• HGNC: 10431
• e!Ensembl: ENSG00000071242

Protein

• UniProt ID: Q15349
• Protein name: Ribosomal protein S6 kinase alpha-2 (S6K-alpha-2) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 2) (p90-RSK 2) (p90RSK2) (MAP kinase-activated protein kinase 1c) (MAPK-activated protein kinase 1c) (MAPKAP kinase 1c) (MAPKAPK-1c) (Ribosomal S6 kinase 3
• Protein function: Serine/threonine-protein kinase that acts downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and mediates mitogenic and stress-induced activation of transcription factors, regulates translation, and mediates cellular proliferation, survival
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	59 → 318	Protein kinase domain	Domain
  PF00433	Pkinase_C	340 → 378	Protein kinase C terminal domain	Family
  PF00069	Pkinase	415 → 672	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed with higher expression in lung, skeletal muscle, brain, uterus, ovary, thyroid and prostate. {ECO:0000269|PubMed:16878154, ECO:0000269|PubMed:7623830}.
• Sequence:

  MDLSMKKFAVRRFFSVYLRRKSRSKSSSLSRLEEEGVVKEIDISHHVKEGFEKADPSQFE
  LLKVLGQGSYGKVFLVRKVKGSDAGQLYAMKVLKKATLKVRDRVRSKMERDILAEVNHPF
  IVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGI
  IYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKRAYSFCGTIEYMAPEVVNRRGHTQSA
  DWWSFGVLMFEMLTGSLPFQGKDRKETMALILKAKLGMPQFLSGEAQSLLRALFKRNPCN
  RLGAGIDGVEEIKRHPFFVTIDWNTLYRKEIKPPFKPAVGRPEDTFHFDPEFTARTPTDS
  PGVPPSANAHHLFRGFSFVASSLIQEPSQQDLHKVPVHPIVQQLHGNNIHFTDGYEIKED
  IGVGSYSVCKRCVHKATDTEYAVKIIDKSKRDPSEEIEILLRYGQHPNIITLKDVYDDGK
  FVYLVMELMRGGELLDRILRQRYFSEREASDVLCTITKTMDYLHSQGVVHRDLKPSNILY
  RDESGSPESIRVCDFGFAKQLRAGNGLLMTPCYTANFVAPEVLKRQGYDAACDIWSLGIL
  LYTMLAGFTPFANGPDDTPEEILARIGSGKYALSGGNWDSISDAAKDVVSKMLHVDPHQR
  LTAMQVLKHPWVVNREYLSPNQLSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLA
  QRRGMKRLTSTRL

• Sequence length: 733

Pathways

KEGG:

MAPK signaling pathway
Oocyte meiosis
mTOR signaling pathway
Thermogenesis
Long-term potentiation
Neurotrophin signaling pathway
Progesterone-mediated oocyte maturation
Insulin resistance
Yersinia infection
Chemical carcinogenesis - receptor activation

Reactome:

ERK/MAPK targets
CREB phosphorylation
Senescence-Associated Secretory Phenotype (SASP)
CREB1 phosphorylation through NMDA receptor-mediated activation of RAS signaling
RSK activation
Gastrin-CREB signalling pathway via PKC and MAPK

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism spectrum disorder	association	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FEMALE REPRODUCTIVE SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACROVASCULAR COMPLICATIONS OF DIABETES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of large intestine	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	31043756		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	31043756		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	19287968, 23635776, 27476168		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19287968, 19514121, 22562547	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	32661241	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26158630		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24205356	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16878154		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21035469, 22523035, 30716361		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21035469	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25197367, 35635239, 37382881	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	37331566	Associate	★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	24556642	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressed bipolar I disorder	Depressed bipolar disorder	GWASCAT_DG	31043756		★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	31043756		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33430853	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28837395		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	33430853	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	29361117		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	30372737		★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	24205356	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	16878154		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31701625		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31701625	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	27886173, 36029471	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	21368869	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	34602526, 35364561	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31836141		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19287968, 23635776, 27476168		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26158630		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24403857, 28679769		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24740858		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19287968, 26011941, 26158630, 28718440, 29351904		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21035469, 22523035, 30716361		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15112576		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	31043756		★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	31043756		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24627490, 25002506, 31678930, 34411141	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16878154, 19287968, 20045011, 25713416, 26011941, 27557521, 28385776		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	31959052	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	Pubtator	32869517	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30397228	Associate	★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	27692602		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24879340	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	24403857, 28679769		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28679769	Associate	★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	29361117		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24740858		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25472581	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	21035469		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	15210573		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24205356		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33660438	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26011941, 27528706		★☆☆☆☆ Found in Text Mining only