Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6195
Gene name	Ribosomal protein S6 kinase A1
Gene symbol	RPS6KA1
Synonyms (NCBI Gene)	HU-1MAPKAPK1MAPKAPK1ARSKRSK1p90Rsk
Chromosome	1
Chromosome location	1p36.11
Summary	This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) si

138

Show/Hide all (138)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006430	hsa-miR-125b-5p	Luciferase reporter assay	21643012
MIRT006430	hsa-miR-125b-5p	Luciferase reporter assay	21643012
MIRT006430	hsa-miR-125b-5p	Luciferase reporter assay	21643012
MIRT006430	hsa-miR-125b-5p	Luciferase reporter assay	21643012
MIRT006430	hsa-miR-125b-5p	ELISAGFP reporter assayImmunoblotImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	21643012
MIRT006430	hsa-miR-125b-5p	ELISAGFP reporter assayImmunoblotImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	21643012
MIRT006430	hsa-miR-125b-5p	Luciferase reporter assay	21643012
MIRT006430	hsa-miR-125b-5p	Luciferase reporter assay	21643012
MIRT006430	hsa-miR-125b-5p	ELISAGFP reporter assayImmunoblotImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	21643012
MIRT006430	hsa-miR-125b-5p	ELISAGFP reporter assayImmunoblotImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	21643012
MIRT041478	hsa-miR-193b-3p	CLASH	23622248
MIRT722120	hsa-miR-320a	HITS-CLIP	19536157
MIRT722119	hsa-miR-320b	HITS-CLIP	19536157
MIRT722118	hsa-miR-320c	HITS-CLIP	19536157
MIRT722117	hsa-miR-320d	HITS-CLIP	19536157
MIRT722116	hsa-miR-4429	HITS-CLIP	19536157
MIRT722115	hsa-miR-4733-5p	HITS-CLIP	19536157
MIRT722114	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT722113	hsa-miR-4744	HITS-CLIP	19536157
MIRT722112	hsa-miR-4509	HITS-CLIP	19536157
MIRT722111	hsa-miR-520f-5p	HITS-CLIP	19536157
MIRT722110	hsa-miR-1301-5p	HITS-CLIP	19536157
MIRT722109	hsa-miR-6502-5p	HITS-CLIP	19536157
MIRT722108	hsa-miR-4713-3p	HITS-CLIP	19536157
MIRT722107	hsa-miR-638	HITS-CLIP	19536157
MIRT722106	hsa-miR-6756-5p	HITS-CLIP	19536157
MIRT722105	hsa-miR-6766-5p	HITS-CLIP	19536157
MIRT722104	hsa-miR-4654	HITS-CLIP	19536157
MIRT722103	hsa-miR-4769-5p	HITS-CLIP	19536157
MIRT722102	hsa-miR-450b-3p	HITS-CLIP	19536157
MIRT722101	hsa-miR-769-3p	HITS-CLIP	19536157
MIRT006430	hsa-miR-125b-5p	Luciferase reporter assayqRT-PCRWestern blot	27613090
MIRT722120	hsa-miR-320a	HITS-CLIP	19536157
MIRT722119	hsa-miR-320b	HITS-CLIP	19536157
MIRT722118	hsa-miR-320c	HITS-CLIP	19536157
MIRT722117	hsa-miR-320d	HITS-CLIP	19536157
MIRT722116	hsa-miR-4429	HITS-CLIP	19536157
MIRT722115	hsa-miR-4733-5p	HITS-CLIP	19536157
MIRT722114	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT722113	hsa-miR-4744	HITS-CLIP	19536157
MIRT722112	hsa-miR-4509	HITS-CLIP	19536157
MIRT722111	hsa-miR-520f-5p	HITS-CLIP	19536157
MIRT722110	hsa-miR-1301-5p	HITS-CLIP	19536157
MIRT722109	hsa-miR-6502-5p	HITS-CLIP	19536157
MIRT722108	hsa-miR-4713-3p	HITS-CLIP	19536157
MIRT722107	hsa-miR-638	HITS-CLIP	19536157
MIRT722106	hsa-miR-6756-5p	HITS-CLIP	19536157
MIRT722105	hsa-miR-6766-5p	HITS-CLIP	19536157
MIRT722104	hsa-miR-4654	HITS-CLIP	19536157
MIRT722103	hsa-miR-4769-5p	HITS-CLIP	19536157
MIRT722102	hsa-miR-450b-3p	HITS-CLIP	19536157
MIRT722101	hsa-miR-769-3p	HITS-CLIP	19536157
MIRT1318004	hsa-miR-106a	CLIP-seq
MIRT1318005	hsa-miR-106b	CLIP-seq
MIRT1318006	hsa-miR-1245b-3p	CLIP-seq
MIRT1318007	hsa-miR-1253	CLIP-seq
MIRT1318008	hsa-miR-125a-5p	CLIP-seq
MIRT1318009	hsa-miR-125b	CLIP-seq
MIRT1318010	hsa-miR-1343	CLIP-seq
MIRT1318011	hsa-miR-17	CLIP-seq
MIRT1318012	hsa-miR-20a	CLIP-seq
MIRT1318013	hsa-miR-20b	CLIP-seq
MIRT1318014	hsa-miR-2110	CLIP-seq
MIRT1318015	hsa-miR-3157-5p	CLIP-seq
MIRT1318016	hsa-miR-4271	CLIP-seq
MIRT1318017	hsa-miR-4315	CLIP-seq
MIRT1318018	hsa-miR-4319	CLIP-seq
MIRT1318019	hsa-miR-4520a-3p	CLIP-seq
MIRT1318020	hsa-miR-4533	CLIP-seq
MIRT1318021	hsa-miR-4667-5p	CLIP-seq
MIRT1318022	hsa-miR-4691-3p	CLIP-seq
MIRT1318023	hsa-miR-4700-5p	CLIP-seq
MIRT1318024	hsa-miR-4725-3p	CLIP-seq
MIRT1318025	hsa-miR-4747-5p	CLIP-seq
MIRT1318026	hsa-miR-4753-5p	CLIP-seq
MIRT1318027	hsa-miR-4789-5p	CLIP-seq
MIRT1318028	hsa-miR-4790-5p	CLIP-seq
MIRT1318029	hsa-miR-4793-5p	CLIP-seq
MIRT1318030	hsa-miR-519d	CLIP-seq
MIRT1318031	hsa-miR-548t	CLIP-seq
MIRT1318032	hsa-miR-561	CLIP-seq
MIRT1318033	hsa-miR-93	CLIP-seq
MIRT1318034	hsa-miR-3192	CLIP-seq
MIRT1318035	hsa-miR-4314	CLIP-seq
MIRT1318036	hsa-miR-4646-5p	CLIP-seq
MIRT1318037	hsa-miR-4728-3p	CLIP-seq
MIRT1318025	hsa-miR-4747-5p	CLIP-seq
MIRT1318038	hsa-miR-592	CLIP-seq
MIRT1318039	hsa-miR-597	CLIP-seq
MIRT1318040	hsa-miR-628-5p	CLIP-seq
MIRT1318041	hsa-miR-892a	CLIP-seq
MIRT1318042	hsa-miR-943	CLIP-seq
MIRT2094500	hsa-miR-1286	CLIP-seq
MIRT2094501	hsa-miR-214	CLIP-seq
MIRT2094502	hsa-miR-320e	CLIP-seq
MIRT2094503	hsa-miR-3619-5p	CLIP-seq
MIRT2094504	hsa-miR-4436a	CLIP-seq
MIRT2094505	hsa-miR-4530	CLIP-seq
MIRT2094506	hsa-miR-4786-3p	CLIP-seq
MIRT2094507	hsa-miR-671-5p	CLIP-seq
MIRT2094508	hsa-miR-761	CLIP-seq
MIRT2318991	hsa-miR-1226	CLIP-seq
MIRT1318007	hsa-miR-1253	CLIP-seq
MIRT2318992	hsa-miR-1276	CLIP-seq
MIRT2318993	hsa-miR-191	CLIP-seq
MIRT2318994	hsa-miR-28-5p	CLIP-seq
MIRT2318995	hsa-miR-3139	CLIP-seq
MIRT2318996	hsa-miR-3160-3p	CLIP-seq
MIRT2318997	hsa-miR-326	CLIP-seq
MIRT2318998	hsa-miR-330-5p	CLIP-seq
MIRT2318999	hsa-miR-3692	CLIP-seq
MIRT2319000	hsa-miR-4283	CLIP-seq
MIRT2319001	hsa-miR-4293	CLIP-seq
MIRT2319002	hsa-miR-4311	CLIP-seq
MIRT1318017	hsa-miR-4315	CLIP-seq
MIRT2319003	hsa-miR-4489	CLIP-seq
MIRT2094505	hsa-miR-4530	CLIP-seq
MIRT2319004	hsa-miR-4537	CLIP-seq
MIRT1318021	hsa-miR-4667-5p	CLIP-seq
MIRT1318023	hsa-miR-4700-5p	CLIP-seq
MIRT2319005	hsa-miR-4773	CLIP-seq
MIRT1318028	hsa-miR-4790-5p	CLIP-seq
MIRT1318029	hsa-miR-4793-5p	CLIP-seq
MIRT2319006	hsa-miR-583	CLIP-seq
MIRT2319007	hsa-miR-634	CLIP-seq
MIRT2319008	hsa-miR-637	CLIP-seq
MIRT2319009	hsa-miR-708	CLIP-seq
MIRT2319010	hsa-miR-922	CLIP-seq
MIRT2318999	hsa-miR-3692	CLIP-seq
MIRT2614707	hsa-miR-10a	CLIP-seq
MIRT2614708	hsa-miR-10b	CLIP-seq
MIRT2614709	hsa-miR-339-5p	CLIP-seq
MIRT2614710	hsa-miR-3646	CLIP-seq
MIRT2614711	hsa-miR-3667-5p	CLIP-seq
MIRT2614712	hsa-miR-3915	CLIP-seq
MIRT2614713	hsa-miR-3928	CLIP-seq
MIRT2614714	hsa-miR-4725-5p	CLIP-seq
MIRT2614715	hsa-miR-504	CLIP-seq

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	10679322, 22357623
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	8141249
GO:0004711	Function	Ribosomal protein S6 kinase activity	IBA
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IDA	22797923
GO:0005515	Function	Protein binding	IPI	19470470, 21423205, 22130794, 22939624, 23455922, 23519423, 24189400, 25513777, 29997244, 30126976, 31837246, 31980649, 32814053, 33961781, 34591642, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	IMP	35772404
GO:0007165	Process	Signal transduction	TAS	8141249
GO:0007268	Process	Chemical synaptic transmission	TAS
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030307	Process	Positive regulation of cell growth	TAS	18813292
GO:0032007	Process	Negative regulation of TOR signaling	IMP	35772404
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0038202	Process	TORC1 signaling	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	18402937
GO:0043066	Process	Negative regulation of apoptotic process	IMP	11684016
GO:0043555	Process	Regulation of translation in response to stress	TAS	18813292
GO:0045202	Component	Synapse	IEA
GO:0045597	Process	Positive regulation of cell differentiation	TAS	18813292
GO:0045893	Process	Positive regulation of DNA-templated transcription	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	22065586
GO:0046872	Function	Metal ion binding	IEA
GO:0072574	Process	Hepatocyte proliferation	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:2000491	Process	Positive regulation of hepatic stellate cell activation	IMP	10679322

MIM	HGNC	e!Ensembl
601684	10430	ENSG00000117676

Q15418

Protein name

Ribosomal protein S6 kinase alpha-1 (S6K-alpha-1) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (p90RSK1) (p90S6K) (MAP kinase-activated protein kinase 1a) (MAPK-activated protein kinase 1a) (MAPKAP kinase 1a) (MAPKAPK-1a) (Ribosomal S6

Protein function

Serine/threonine-protein kinase that acts downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and mediates mitogenic and stress-induced activation of the transcription factors CREB1, ETV1/ER81 and NR4A1/NUR77, regulates translation through R

PDB

2WNT , 2Z7Q , 2Z7R , 2Z7S , 3RNY , 3TEI , 4H3P , 4NIF , 5CSF , 5CSI , 5CSJ , 5CSN , 5N7D , 5N7F , 5N7G , 5V61 , 5V62 , 6TWY , 7P74 , 7PC8 , 7QQL , 8WF4 , 8XOV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	62 → 321	Protein kinase domain	Domain
PF00433	Pkinase_C	342 → 381	Protein kinase C terminal domain	Family
PF00069	Pkinase	418 → 675	Protein kinase domain	Domain

Sequence

MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHVKAGSEKADPS
HFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVN
HPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHS
LGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHS
HSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRN
PANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYFDTEFTSRTP
KDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSDGYVV
KETIGVGSYSECKRCVHKATNMEYAVKVIDKSKRDPSEEIEILLRYGQHPNIITLKDVYD
DGKHVYLVTELMRGGELLDKILRQKFFSEREASFVLHTIGKTVEYLHSQGVVHRDLKPSN
ILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSL
GILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDP
HQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESS
ILAQRRVRKLPSTTL

Sequence length

735

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Oocyte meiosis mTOR signaling pathway Thermogenesis Long-term potentiation Neurotrophin signaling pathway Progesterone-mediated oocyte maturation Insulin resistance Yersinia infection Chemical carcinogenesis - receptor activation		ERK/MAPK targets CREB phosphorylation Senescence-Associated Secretory Phenotype (SASP) CREB1 phosphorylation through NMDA receptor-mediated activation of RAS signaling RSK activation Gastrin-CREB signalling pathway via PKC and MAPK

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COMPLEX REGIONAL PAIN SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEZARY SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (67)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	31756944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27236820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	31196199	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	23243209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	35417913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	23243209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17908967, 23216670, 23635776, 24805830, 26977024, 27028868, 27476168, 29498411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23216670, 24805830, 27028868, 31818359, 32711446, 39218304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21423205, 26158630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26625210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30586719, 30813401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31076505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21035469, 22523035, 30716361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21035469	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34373442	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29339024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23243209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31932636, 34502231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	31505737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	29361117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	30372737		★★★★★ ★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	32321919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31701625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31701625	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31701625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31701625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	27063456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22216126	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30813401, 31505737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23377826, 34502231, 37462338, 39333927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31756944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31836141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	21423205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28592245, 32928150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	39329730	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17908967, 23216670, 23635776, 24805830, 26977024, 27028868, 27476168, 29498411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21423205, 26158630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26625210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28679769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24740858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23216670, 26011941, 26158630, 26977024, 27236820, 27528706, 28718440, 29351904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21035469, 22523035, 30716361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15112576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26977024		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28599981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	39329730	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15342917, 20045011, 23216670, 25713416, 26011941, 27236820, 27557521, 28385776, 29498411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	23144792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27236820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	23216670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	29339024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26625210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28679769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	29361117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24740858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	21035469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31076505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	28957431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	CTD_human_DG	26551670		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sezary Syndrome	Sezary syndrome	Pubtator	26551670	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	15613460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24205356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33291786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	39329730	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	23593654, 26011941, 27528706, 29498411, 31818359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	23593654, 27028868, 27049728, 31818359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RPS6KA1 (ribosomal protein S6 kinase A1)