RPLP2 (ribosomal protein lateral stalk subunit P2)

Gene

• Entrez ID: 6181
• Gene name: Ribosomal protein lateral stalk subunit P2
• Gene symbol: RPLP2
• Synonyms (NCBI Gene): D11S2243E, LP2, P2, RPP2
• Chromosome: 11
• Chromosome location: 11p15.5
• Summary: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pho

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT051678	hsa-let-7e-5p	CLASH	23622248
MIRT041698	hsa-miR-484	CLASH	23622248
MIRT039035	hsa-miR-766-3p	CLASH	23622248
MIRT037947	hsa-miR-505-5p	CLASH	23622248
MIRT1317075	hsa-miR-1909	CLIP-seq
MIRT1317076	hsa-miR-939	CLIP-seq
MIRT1317075	hsa-miR-1909	CLIP-seq
MIRT1317076	hsa-miR-939	CLIP-seq
MIRT1317075	hsa-miR-1909	CLIP-seq
MIRT1317076	hsa-miR-939	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002181	Process	Cytoplasmic translation	NAS	25901680
GO:0002182	Process	Cytoplasmic translational elongation	IEA
GO:0003735	Function	Structural constituent of ribosome	IDA	3323886
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0003735	Function	Structural constituent of ribosome	NAS	12962325
GO:0005515	Function	Protein binding	IPI	22135285
GO:0005737	Component	Cytoplasm	NAS	25901680
GO:0005829	Component	Cytosol	TAS
GO:0005840	Component	Ribosome	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006412	Process	Translation	NAS	12962325
GO:0006414	Process	Translational elongation	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0022625	Component	Cytosolic large ribosomal subunit	HDA	12962325
GO:0022625	Component	Cytosolic large ribosomal subunit	IDA	3323886
GO:0022625	Component	Cytosolic large ribosomal subunit	IEA
GO:0022625	Component	Cytosolic large ribosomal subunit	IPI	25901680
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:1990904	Component	Ribonucleoprotein complex	IEA

Other IDs

• MIM: 180530
• HGNC: 10377
• e!Ensembl: ENSG00000177600

Protein

• UniProt ID: P05387
• Protein name: Large ribosomal subunit protein P2 (60S acidic ribosomal protein P2) (Renal carcinoma antigen NY-REN-44)
• Protein function: Plays an important role in the elongation step of protein synthesis.
• PDB: 1S4J, 2JDL, 2LBF, 2W1O, 4BEH, 4V6X, 5DDZ, 5GU4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00428	Ribosomal_60s	17 → 114		Family

• Sequence:

  MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIG
  KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD

• Sequence length: 115

Pathways

KEGG:

Ribosome
Coronavirus disease - COVID-19

Reactome:

L13a-mediated translational silencing of Ceruloplasmin expression
SRP-dependent cotranslational protein targeting to membrane
Viral mRNA Translation
Major pathway of rRNA processing in the nucleolus and cytosol
Formation of a pool of free 40S subunits
GTP hydrolysis and joining of the 60S ribosomal subunit
Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)
Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AORTIC STENOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE CALCIFICATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FUCHS' ENDOTHELIAL DYSTROPHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATOCONUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	29915430		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	1370760, 26176264, 36936167, 39512680	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis Ulcerative	Ulcerative colitis	Pubtator	26419460	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	9292708	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	32685558	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26419460		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26419460	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	33761671	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21040949		★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	LHGDN	16920697		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	26419460		★☆☆☆☆ Found in Text Mining only