Gene Gene information from NCBI Gene database.
Entrez ID 6152
Gene name Ribosomal protein L24
Gene symbol RPL24
Synonyms (NCBI Gene)
HEL-S-310L24eL24
Chromosome 3
Chromosome location 3q12.3
Summary Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pro
miRNA miRNA information provided by mirtarbase database.
78
miRTarBase ID miRNA Experiments Reference
MIRT050454 hsa-miR-22-3p CLASH 23622248
MIRT048982 hsa-miR-92a-3p CLASH 23622248
MIRT040955 hsa-miR-18a-3p CLASH 23622248
MIRT716128 hsa-miR-1277-5p HITS-CLIP 19536157
MIRT716127 hsa-miR-302a-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
40
GO ID Ontology Definition Evidence Reference
GO:0000027 Process Ribosomal large subunit assembly IEA
GO:0002181 Process Cytoplasmic translation IBA
GO:0002181 Process Cytoplasmic translation IC 23636399
GO:0002181 Process Cytoplasmic translation IDA 25957688, 32669547, 34314702
GO:0002181 Process Cytoplasmic translation NAS 25901680
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604180 10325 ENSG00000114391
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P83731
Protein name Large ribosomal subunit protein eL24 (60S ribosomal protein L24) (60S ribosomal protein L30)
Protein function Component of the large ribosomal subunit. The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell.
PDB 4UG0 , 4V6X , 5A2Q , 5AJ0 , 5LKS , 5T2C , 6IP5 , 6IP6 , 6IP8 , 6LQM , 6LSR , 6OLE , 6OLF , 6OLG , 6OLI , 6OLZ , 6OM0 , 6OM7 , 6QZP , 6W6L , 6XA1 , 6Y0G , 6Y2L , 6Y57 , 6Y6X , 6Z6L , 6Z6M , 6Z6N , 6ZM7 , 6ZME , 6ZMI , 6ZMO , 7BHP , 7F5S , 7OW7 , 7XNX , 7XNY , 8A3D , 8G5Y , 8G60 , 8G61 , 8G6J , 8GLP , 8IFD , 8IFE , 8JDJ , 8JDK , 8JDL , 8JDM , 8K2C , 8OHD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01246 Ribosomal_L24e 1 66 Ribosomal protein L24e Domain
Sequence
MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHK
KGQSEE
IQKKRTRRAVKFQRAITGASLADIMAKRNQKPEVRKAQREQAIRAAKEAKKAKQ
ASKKTAMAAAKAPTKAAPKQKIVKPVKVSAPRVGGKR
Sequence length 157
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Ribosome
Coronavirus disease - COVID-19
  L13a-mediated translational silencing of Ceruloplasmin expression
SRP-dependent cotranslational protein targeting to membrane
Viral mRNA Translation
Major pathway of rRNA processing in the nucleolus and cytosol
Formation of a pool of free 40S subunits
GTP hydrolysis and joining of the 60S ribosomal subunit
Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)
Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
GASTROINTESTINAL STROMAL TUMORS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations