Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	613
Gene name	BCR activator of RhoGEF and GTPase
Gene symbol	BCR
Synonyms (NCBI Gene)	ALLBCR1CMLD22S11D22S662PHL
Chromosome	22
Chromosome location	22q11.23
Summary	A reciprocal translocation between chromosomes 22 and 9 produces the Philadelphia chromosome, which is often found in patients with chronic myelogenous leukemia. The chromosome 22 breakpoint for this translocation is located within the BCR gene. The trans

126

Show/Hide all (126)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048049	hsa-miR-197-3p	CLASH	23622248
MIRT047744	hsa-miR-10a-5p	CLASH	23622248
MIRT037631	hsa-miR-744-5p	CLASH	23622248
MIRT037631	hsa-miR-744-5p	CLASH	23622248
MIRT489914	hsa-miR-3141	PAR-CLIP	23592263
MIRT489912	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT489913	hsa-miR-6125	PAR-CLIP	23592263
MIRT489911	hsa-miR-6853-5p	PAR-CLIP	23592263
MIRT489910	hsa-miR-3202	PAR-CLIP	23592263
MIRT489909	hsa-miR-4743-5p	PAR-CLIP	23592263
MIRT489908	hsa-miR-6877-5p	PAR-CLIP	23592263
MIRT489907	hsa-miR-6781-5p	PAR-CLIP	23592263
MIRT489914	hsa-miR-3141	PAR-CLIP	26701625
MIRT489914	hsa-miR-3141	PAR-CLIP	26701625
MIRT489910	hsa-miR-3202	PAR-CLIP	26701625
MIRT489910	hsa-miR-3202	PAR-CLIP	26701625
MIRT489909	hsa-miR-4743-5p	PAR-CLIP	26701625
MIRT489909	hsa-miR-4743-5p	PAR-CLIP	26701625
MIRT489913	hsa-miR-6125	PAR-CLIP	26701625
MIRT489913	hsa-miR-6125	PAR-CLIP	26701625
MIRT489907	hsa-miR-6781-5p	PAR-CLIP	26701625
MIRT489907	hsa-miR-6781-5p	PAR-CLIP	26701625
MIRT489911	hsa-miR-6853-5p	PAR-CLIP	26701625
MIRT489911	hsa-miR-6853-5p	PAR-CLIP	26701625
MIRT489908	hsa-miR-6877-5p	PAR-CLIP	26701625
MIRT489908	hsa-miR-6877-5p	PAR-CLIP	26701625
MIRT489914	hsa-miR-3141	PAR-CLIP	23592263
MIRT489912	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT489913	hsa-miR-6125	PAR-CLIP	23592263
MIRT489911	hsa-miR-6853-5p	PAR-CLIP	23592263
MIRT489910	hsa-miR-3202	PAR-CLIP	23592263
MIRT489909	hsa-miR-4743-5p	PAR-CLIP	23592263
MIRT489908	hsa-miR-6877-5p	PAR-CLIP	23592263
MIRT489907	hsa-miR-6781-5p	PAR-CLIP	23592263
MIRT820317	hsa-miR-298	CLIP-seq
MIRT820318	hsa-miR-3065-5p	CLIP-seq
MIRT820319	hsa-miR-3126-5p	CLIP-seq
MIRT820320	hsa-miR-3130-3p	CLIP-seq
MIRT820321	hsa-miR-3160-3p	CLIP-seq
MIRT820322	hsa-miR-3646	CLIP-seq
MIRT820323	hsa-miR-3667-5p	CLIP-seq
MIRT820324	hsa-miR-3678-3p	CLIP-seq
MIRT820325	hsa-miR-3689a-3p	CLIP-seq
MIRT820326	hsa-miR-3689c	CLIP-seq
MIRT820327	hsa-miR-4265	CLIP-seq
MIRT820328	hsa-miR-4296	CLIP-seq
MIRT820329	hsa-miR-4312	CLIP-seq
MIRT820330	hsa-miR-4322	CLIP-seq
MIRT820331	hsa-miR-4419a	CLIP-seq
MIRT820332	hsa-miR-4428	CLIP-seq
MIRT820333	hsa-miR-4487	CLIP-seq
MIRT820334	hsa-miR-4510	CLIP-seq
MIRT820335	hsa-miR-4642	CLIP-seq
MIRT820336	hsa-miR-4648	CLIP-seq
MIRT820337	hsa-miR-4654	CLIP-seq
MIRT820338	hsa-miR-4668-3p	CLIP-seq
MIRT820339	hsa-miR-4709-5p	CLIP-seq
MIRT820340	hsa-miR-4720-5p	CLIP-seq
MIRT820341	hsa-miR-4728-5p	CLIP-seq
MIRT820342	hsa-miR-4769-5p	CLIP-seq
MIRT820343	hsa-miR-4793-3p	CLIP-seq
MIRT820344	hsa-miR-4799-3p	CLIP-seq
MIRT820345	hsa-miR-544	CLIP-seq
MIRT820346	hsa-miR-548c-3p	CLIP-seq
MIRT820347	hsa-miR-558	CLIP-seq
MIRT820348	hsa-miR-660	CLIP-seq
MIRT820349	hsa-miR-1267	CLIP-seq
MIRT820350	hsa-miR-1297	CLIP-seq
MIRT820351	hsa-miR-1304	CLIP-seq
MIRT820352	hsa-miR-1324	CLIP-seq
MIRT820353	hsa-miR-1827	CLIP-seq
MIRT820354	hsa-miR-26a	CLIP-seq
MIRT820355	hsa-miR-26b	CLIP-seq
MIRT820356	hsa-miR-3166	CLIP-seq
MIRT820357	hsa-miR-3614-3p	CLIP-seq
MIRT820358	hsa-miR-3689d	CLIP-seq
MIRT820359	hsa-miR-4459	CLIP-seq
MIRT820360	hsa-miR-4465	CLIP-seq
MIRT820361	hsa-miR-4687-3p	CLIP-seq
MIRT820362	hsa-miR-4722-5p	CLIP-seq
MIRT820363	hsa-miR-555	CLIP-seq
MIRT820364	hsa-miR-940	CLIP-seq
MIRT1942419	hsa-miR-1207-5p	CLIP-seq
MIRT1942420	hsa-miR-1909	CLIP-seq
MIRT1942421	hsa-miR-1914	CLIP-seq
MIRT1942422	hsa-miR-204	CLIP-seq
MIRT1942423	hsa-miR-211	CLIP-seq
MIRT1942424	hsa-miR-2355-5p	CLIP-seq
MIRT1942425	hsa-miR-3180-5p	CLIP-seq
MIRT1942426	hsa-miR-4488	CLIP-seq
MIRT1942427	hsa-miR-4688	CLIP-seq
MIRT1942428	hsa-miR-4697-5p	CLIP-seq
MIRT1942429	hsa-miR-4704-3p	CLIP-seq
MIRT1942430	hsa-miR-4713-5p	CLIP-seq
MIRT1942431	hsa-miR-4755-3p	CLIP-seq
MIRT1942432	hsa-miR-4755-5p	CLIP-seq
MIRT1942433	hsa-miR-4763-3p	CLIP-seq
MIRT1942434	hsa-miR-483-3p	CLIP-seq
MIRT1942435	hsa-miR-486-3p	CLIP-seq
MIRT1942436	hsa-miR-548t	CLIP-seq
MIRT1942437	hsa-miR-623	CLIP-seq
MIRT1942438	hsa-miR-637	CLIP-seq
MIRT2181123	hsa-miR-181a	CLIP-seq
MIRT2181124	hsa-miR-181b	CLIP-seq
MIRT2181125	hsa-miR-181c	CLIP-seq
MIRT2181126	hsa-miR-181d	CLIP-seq
MIRT2181127	hsa-miR-198	CLIP-seq
MIRT2181128	hsa-miR-2110	CLIP-seq
MIRT2181129	hsa-miR-219-5p	CLIP-seq
MIRT2181130	hsa-miR-3150a-3p	CLIP-seq
MIRT2181131	hsa-miR-3173-3p	CLIP-seq
MIRT2181132	hsa-miR-3175	CLIP-seq
MIRT2181133	hsa-miR-3190	CLIP-seq
MIRT2181134	hsa-miR-3675-5p	CLIP-seq
MIRT2181135	hsa-miR-3911	CLIP-seq
MIRT2181136	hsa-miR-3918	CLIP-seq
MIRT2181137	hsa-miR-4262	CLIP-seq
MIRT2181138	hsa-miR-4271	CLIP-seq
MIRT2181139	hsa-miR-4533	CLIP-seq
MIRT2181140	hsa-miR-4685-5p	CLIP-seq
MIRT2181141	hsa-miR-4725-3p	CLIP-seq
MIRT820341	hsa-miR-4728-5p	CLIP-seq
MIRT2181142	hsa-miR-4734	CLIP-seq
MIRT2181143	hsa-miR-4747-5p	CLIP-seq
MIRT2181144	hsa-miR-4782-3p	CLIP-seq
MIRT2181145	hsa-miR-939	CLIP-seq

Show/Hide all (71)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002692	Process	Negative regulation of cellular extravasation	IEA
GO:0003014	Process	Renal system process	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	1657398
GO:0004713	Function	Protein tyrosine kinase activity	TAS
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IDA	7479768
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IMP	23940119
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS
GO:0005096	Function	GTPase activator activity	IDA	1903516, 7479768
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS	1903516
GO:0005515	Function	Protein binding	IPI	8112292, 8955135, 8995379, 9174058, 9178913, 9566916, 10887132, 20962234, 21706016, 22153077, 25331951, 28514442, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006468	Process	Protein phosphorylation	TAS	1657398
GO:0006909	Process	Phagocytosis	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	1657398
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	IMP	23940119
GO:0007420	Process	Brain development	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IBA
GO:0016301	Function	Kinase activity	IEA
GO:0016477	Process	Cell migration	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030216	Process	Keratinocyte differentiation	IMP	23940119
GO:0030424	Component	Axon	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032991	Component	Protein-containing complex	IDA	23382219
GO:0035023	Process	Regulation of Rho protein signal transduction	IMP	23940119
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042472	Process	Inner ear morphogenesis	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043114	Process	Regulation of vascular permeability	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0043312	Process	Neutrophil degranulation	IEA
GO:0043314	Process	Negative regulation of neutrophil degranulation	IEA
GO:0045202	Component	Synapse	IEA
GO:0048041	Process	Focal adhesion assembly	IMP	23940119
GO:0048872	Process	Homeostasis of number of cells	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050766	Process	Positive regulation of phagocytosis	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	ISS
GO:0050885	Process	Neuromuscular process controlling balance	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0060216	Process	Definitive hemopoiesis	IEA
GO:0060268	Process	Negative regulation of respiratory burst	IEA
GO:0060313	Process	Negative regulation of blood vessel remodeling	IEA
GO:0065002	Process	Intracellular protein transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0090630	Process	Activation of GTPase activity	IDA	7479768
GO:0090630	Process	Activation of GTPase activity	IMP	23940119
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098685	Component	Schaffer collateral - CA1 synapse	ISS
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098978	Component	Glutamatergic synapse	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1905517	Process	Macrophage migration	IEA
GO:1905522	Process	Negative regulation of macrophage migration	IEA
GO:2000378	Process	Negative regulation of reactive oxygen species metabolic process	IEA

MIM	HGNC	e!Ensembl
151410	1014	ENSG00000186716

P11274

Protein name

Breakpoint cluster region protein (EC 2.7.11.1) (Renal carcinoma antigen NY-REN-26)

Protein function

Protein with a unique structure having two opposing regulatory activities toward small GTP-binding proteins. The C-terminus is a GTPase-activating protein (GAP) domain which stimulates GTP hydrolysis by RAC1, RAC2 and CDC42. Accelerates the intr

PDB

1K1F , 2AIN , 5N6R , 5N7E , 5OC7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09036	Bcr-Abl_Oligo	3 → 75	Bcr-Abl oncoprotein oligomerisation domain	Domain
PF00621	RhoGEF	502 → 689	RhoGEF domain	Domain
PF19057	PH_19	698 → 822		Domain
PF00168	C2	911 → 1017	C2 domain	Domain
PF00620	RhoGAP	1068 → 1220	RhoGAP domain	Domain

Sequence

MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQ
TLLAKEKKSYDRQRWGFRRAAQAPDGASEPRASASRPQPAPADGADPPPAEEPEARPDGE
GSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSC
GVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQSIYVGGMMEGEGKGPLLRSQ
STSEQEKRLTWPRRSYSPRSFEDCGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEG
AFHGDADGSFGTPPGYGCAADRAEEQRRHQDGLPYIDDSPSSSPHLSSKGRGSRDALVSG
ALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGV
AMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDL
LKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVE
GARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDELEAVPNIPLVP
DEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRN
GKSYTFLISSDYERAEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTIN
KEDDESPGLYGFLNVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNE
EFEIELEGSQTLRILCYEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVI
AMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIER
RGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLF
TDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSL
HNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAPDS
KRQSILFSTEV

Sequence length

1271

Interactions

View interactions

	KEGG		Reactome
	Pathways in cancer Chronic myeloid leukemia		Signaling by cytosolic FGFR1 fusion mutants Rho GTPase cycle Signaling by FGFR1 in disease

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (24)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute lymphoid leukemia	Uncertain significance; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-LYMPHOBLASTIC LEUKEMIA/LYMPHOMA WITH T	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLAST CRISIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic myelogenous leukemia, BCR-ABL1 positive	Uncertain significance; not provided; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC MYELOID LEUKEMIA	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISTAL 22Q11.2 MICRODELETION SYNDROME	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, ACUTE LYMPHOBLASTIC	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, CHRONIC MYELOID	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELOPROLIFERATIVE DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (309)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Abetalipoproteinemia	Abetalipoproteinemia	BEFREE	14697634, 7596189, 8035612, 9087564, 9648560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	8207977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	10674911, 11734316, 1317490, 1391801, 1985699, 1993310, 2143795, 23171834, 2388480, 24310817, 24998463, 2569268, 2648256, 2678002, 2693843 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10500826, 10615128, 10640143, 10803934, 11086180, 11369654, 11697484, 12447959, 1353550, 14993251, 15257703, 15315963, 15611260, 15716990, 15908956 View all (120 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	12082639, 17394134, 19360458, 28971504, 8625269, 9393601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	14551738, 23054652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	10611345, 10720132, 12827650, 12899711, 1312695, 1314166, 19100514, 21298367, 2218500, 28654205, 8095167, 9242550, 9815736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	30413411, 30858955, 31817512, 7579412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	31069142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	14993251, 15282669, 15315963, 15611260, 15908956, 16213359, 1747460, 17485517, 19589926, 19759560, 19770381, 1993310, 20013897, 20930648, 21082971 View all (45 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	14551738, 16076492, 8822948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	11999582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	18430472, 22795690, 30113677, 31366526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	10379869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	10803934, 19484761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	BEFREE	21693761, 24216514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	Pubtator	21693761	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	31666081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	23299888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	34625105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	BEFREE	2577871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankyloglossia	Ankyloglossia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arachnodactyly	Arachnodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28280052, 31035012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28850672, 29628928, 31882654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28280052, 31035012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	20394077, 24602812, 31616406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	31616406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	10602421, 11801308, 15120934, 17683977, 18401881, 18986386, 20659155, 21370430, 21593872, 21960589, 22323189, 22895079, 23521501, 24330849, 24501014 View all (26 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	11027651, 12124346, 21652149, 24117128, 26641257		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	12802927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behavioral tic	Tourette syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	15866548, 17822820		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	15866548, 17239033, 17239488, 17822820		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	32747715	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blast Crisis	Blast crisis	Pubtator	15050919, 16304379, 19048492, 19563513, 29022901, 3085701	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	10071076, 10475625, 10673684, 1068530, 1083192, 11343772, 11566347, 11704795, 12370803, 12620409, 15085164, 15109541, 15389905, 1592097, 16076492 View all (87 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	CTD_human_DG	21570118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blepharophimosis	Blepharophimosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Failure Disorders	Bone marrow failure syndromes	Pubtator	2403827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	14529387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25287138, 31811234, 35317849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Leukemia	Burkitt`s Lymphoma	BEFREE	21391972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	10438726, 11027651, 12594826, 27155012, 28064214, 29669863, 30617194, 34160140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	11027651, 19332026, 28515100, 3930157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	ORPHANET_DG	23491079		★★★★★ ★☆☆☆☆ Found in Text Mining only
CAMPOMELIC DYSPLASIA	Campomelic Dysplasia	BEFREE	17204049, 17255768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29022901	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33591648, 34104084	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32955083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17459062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31098421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	24797802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	38067150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cat eye syndrome	Cat Eye Syndrome	BEFREE	12599190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	28451802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	12154021, 14993251, 15315963, 15611260, 15908956, 16213359, 1747460, 17485517, 19589926, 19759560, 1993310, 20013897, 20930648, 21082971, 21944569 View all (43 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	14551738, 16076492, 7567936, 8822948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	10379869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choanal Atresia	Choanal Atresia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome 22q11.2 Deletion Syndrome, Distal	Chromosome 22q11.2 Deletion Syndrome	ORPHANET_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
CHROMOSOME 8p11 MYELOPROLIFERATIVE SYNDROME	8p11 Myeloproliferative Syndrome	BEFREE	30413411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	21318952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic eosinophilic leukemia	Eosinophilic Leukemia	BEFREE	17215855, 17587879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28298076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic leukemia (category)	Leukemia	BEFREE	24419302, 8251902, 9676840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10792036, 10803934, 12802927, 16773185, 19347734, 20940416, 22415752, 22692508, 22715122, 23742949, 24054703, 24117128, 24719462, 24817955, 24917358 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloid leukemia	Myeloid Leukemia	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	10586207, 11746971, 12023981, 15870860, 1615925, 17255768, 18767145, 19175693, 19466975, 19605820, 19939582, 20428194, 20553273, 21245760, 21646683 View all (54 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Neutrophilic Leukemia	Neutrophilic Leukemia	BEFREE	12472276, 23656643, 23896413, 25575036, 26637732, 30458320, 30473959, 30581159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly of the 5th finger	Camptodactyly of fingers	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	23825635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17196995, 22167334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17196995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23825635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	21287551, 22940579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	21287551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete hydatidiform mole	Complete Hydatidiform Mole	BEFREE	7980523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	10565297, 12430926, 14560778, 14987402, 15282669, 16044457, 16076492, 18034597, 18503828, 1961015, 2182595, 22372202, 22411871, 23284724, 23543457 View all (17 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermoid Cyst	Dermoid Cyst	BEFREE	7980523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28280052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28280052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	22105996, 40117290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	31150624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25710801, 30467969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	25710801, 30227659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	26537529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	11999582, 19758698, 31189540		★★★★★ ★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	DiGeorge Syndrome	BEFREE	2339689		★★★★★ ★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	2339689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Distal 22q11.2 microdeletion syndrome	Distal 22q11.2 Microdeletion Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Down Syndrome	Down Syndrome	BEFREE	20442364, 9352800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	25049327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	19175693, 24813417, 26095243, 27134074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	20955401, 33022638, 36698221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic leukemia	Eosinophilic Leukemia	BEFREE	8289488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	12522555, 1639418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	28224300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	28188414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	21203397	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	21519342		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	21519342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fecal Incontinence	Bowel incontinence	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fistula of branchial cleft	Fistula Of Branchial Cleft	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	1710175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallstones	Gallstones	Pubtator	24083370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	19366796, 26373844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized enlarged lymph nodes	Enlarged Lymph Nodes	BEFREE	2168506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	12451475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30936198	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	12451475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30936198	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	29568935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	22795690, 24698424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	12893773, 15389905, 19135771, 20417861, 2224129, 23637631, 2563665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	14757535, 20417861, 2224129, 22762548, 23171811, 23862671, 26149409, 27134074, 27705929, 28804122, 2902258, 29660671, 29913272, 30574454, 30705677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	15257703, 16341034, 23742949, 3172841, 3263550, 8640172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	12759926, 18538733, 22904675, 25775523, 27283163, 30019447, 31105873, 9639410		★★★★★ ★☆☆☆☆ Found in Text Mining only
HEMOPHAGOCYTIC LYMPHOHISTIOCYTOSIS, FAMILIAL, 2	Hemophagocytic Lymphohistiocytosis	BEFREE	7600533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	23107779, 32859541, 33890726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	18430472, 1916688, 22795690, 2651801, 29790693, 30113677, 31366526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypereosinophilia	Hypereosinophilia	BEFREE	30210745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	12594826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	37730603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21071498	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21347297	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28283735		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	29568935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	29023488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	19901108, 20882436, 22195406, 24164563, 3486010, 7567936, 9078304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	25631082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	24330849		★★★★★ ★☆☆☆☆ Found in Text Mining only
L2 Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Disorders	Language Disorders	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10390197, 10565297, 10615128, 10975389, 12451475, 12476302, 12594572, 12681364, 1346543, 1434816, 14630694, 15087374, 15254401, 15703781, 16105974 View all (124 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10682862, 10688835, 12594572, 12642693, 12881321, 12893773, 14993251, 15039284, 15042680, 15502840, 15939795, 16042351, 16141323, 16393970, 1705008 View all (67 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	12408765, 15723338, 18227349, 18603297, 18704194, 18809762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	18540961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	16042351, 30049824	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	12920036, 16304046, 1985699, 21275954, 23519513, 23806810, 26017033, 2678002, 26802623, 2930840, 3164571, 32859541, 32871908, 33433047, 33647814 View all (9 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	9233586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	27061824	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Neutrophilic Chronic	Neutrophilic leukemia	Pubtator	9038742, 9886327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10361105, 11086180, 12082639, 12363468, 14551738, 15085163, 16076492, 16213359, 16518848, 16645213, 17394134, 18339423, 18503828, 19360458, 19491417 View all (43 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	16490599, 16670264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myeloid, Accelerated Phase	Myeloid Leukemia	BEFREE	22328017, 24332214, 28086219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myeloid, Chronic, Atypical, BCR-ABL Negative	Myeloid Leukemia	BEFREE	10586207, 12023981, 12944919, 15034867, 1826535, 23222956, 30078497, 30458320, 31594785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	10586207, 17041567, 19901108, 2205309, 22513837, 24164563, 7567936, 7812917, 8818385, 9078304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	10803934, 10851082, 8616868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	9149044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	31245199, 9149044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17459062	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	25957308, 29632142, 30333834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19380809, 31616406, 35092307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	25957308, 29632142, 30333834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19380809, 22647731, 25957308, 29632142, 30333834, 30373855, 30840855, 31616406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	25957308, 29632142, 30333834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	BEFREE	27040704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	16205638, 18809762, 21822204, 28551329, 30401948, 30790375, 31173268, 8127157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10435590, 11086180, 11999582, 12688328, 1602794, 23862671, 24419302, 28919770, 28993409, 29367757, 29898964, 30413411, 30753270, 6602651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	16809616, 19828640, 20543139, 27166259, 31439673, 33591648, 36698221, 36881367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	20543139, 25784678, 31042459, 37899130, 38096368, 39501370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	12023577, 14987231, 26641257, 2682663, 27693433, 28515100, 2865728, 3014037, 3186743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	11999582, 30113677, 7509622, 7803295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	30113677, 7509622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	31299112, 3304468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	15866548		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	15866548		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	14529387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17459062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15999149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23341502, 28188414, 28550473, 28782483, 30616601, 31485740, 31492993, 31559475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	1684291, 16888615, 19037256, 19822752, 21164221, 22415752, 23148371, 23575065, 25183062, 25368816, 26373844, 2676087, 27693433, 27856601, 28241101 View all (29 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24916698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	23231952, 30413649, 31534006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	19175693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	10379869, 11107174		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24281418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	1648958, 18474292, 20809251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	18474292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Microstomia	Microstomia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	12082639, 25833723, 27654852, 9208122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Milroy Disease	Milroy Disease	BEFREE	10803934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed phenotype acute leukemia	Mixed Phenotype Leukemia	BEFREE	22372202, 24532437, 24998463, 30019150, 7901455, 8822948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	2070054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11356834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12430902, 2232886, 23862671, 24419302, 30753270, 7496137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	26055752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	39551364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	20104489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	7567936		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	12082639, 1859889, 25833723, 27654852, 27899359, 28743306, 30113677, 7567936, 8490181, 9208122, 9447819, 9639410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	12898186, 36307214, 9266939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic-Myeloproliferative Diseases	Myelodysplastic-Myeloproliferative Diseases	BEFREE	18555525, 27161873, 31594785, 3279513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	1372840, 16044457, 16321848, 19141119, 22793267, 25232060, 25520049, 26933174, 27017614, 28543980, 29562644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	10840937, 1391801, 1903358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	LHGDN	12890867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10025763, 10224280, 10361105, 10373061, 10442632, 10463572, 10492071, 10526530, 10534772, 10549264, 10586207, 10615128, 10739005, 10803934, 10950939 View all (745 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	12408765, 12734675, 12781448, 14656881, 15626746, 15716990, 16079118, 16442619, 16449534, 16502580, 16596225, 16598834, 16631477, 16855631, 16888785 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	CTD_human_DG	15604220, 18673174, 21908430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	ORPHANET_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	11746971, 15870860, 17215855, 18767145, 19175693, 19562618, 19605820, 19959796, 21245760, 21474922, 21646683, 21723416, 21742423, 22035746, 22328017 View all (67 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	LHGDN	11746971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	CTD_human_DG	22875613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	16225651, 17249502, 18757400, 21318952, 22511494, 23519513, 23599815, 26291129, 29500381, 33541399, 34493159, 35574218, 7565761, 9038742	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myeloproliferative Neoplasm, Unclassifiable	Myeloproliferative Neoplasm	BEFREE	27134074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	37171806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	34050324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10865964, 11904740, 15389905, 15913951, 16034468, 17285572, 18474292, 21063398, 21674564, 2182595, 23287430, 23319824, 23575065, 23656643, 24091144 View all (28 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	15661271, 17728783, 2574149, 2577871, 9669676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	26015512	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	7565761	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25331951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	12821741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	26015512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30428415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	28530220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive compulsive behavior	Obsessive-Compulsive Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculomotor apraxia	Oculomotor apraxia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculovestibuloauditory syndrome	Oculovestibuloauditory Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	1698437		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24916698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15999149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	18343792, 29880247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31251998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	35250991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilomyxoid astrocytoma	Pilomyxoid Astrocytoma	BEFREE	17080723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	28971265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	LHGDN	12408765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	BEFREE	22234689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	Pubtator	26187587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	LHGDN	12408765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	19843380, 22035746, 22234689, 22793267, 22847163, 23986553, 25486952, 26182311, 26492355, 26933174, 27017614, 27039813, 28406068, 29134817, 31340059, 8818385 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	26187587, 29611379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	12154412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	23171811, 24729118, 24821775, 25337274, 30181314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell acute lymphoblastic leukemia	Lymphoblastic Leukemia	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	12154021, 15713800, 1827853, 20082857, 20666852, 21435002, 21884299, 22234689, 23098889, 23171811, 23491079, 24729118, 25337274, 25775523, 27815723 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	ORPHANET_DG	23491079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	12154021, 20082857, 23098889, 24729118, 29531323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	10500826, 10640143, 11369654, 11697484, 12447959, 16205638, 1684291, 18603297, 19587702, 19770381, 1984685, 20534699, 21822204, 23804397, 23911702 View all (28 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	15716990, 17762503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-cell acute lymphoblastic leukemia	Lymphoblastic Leukemia	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	15713800, 1717256, 1741251, 2304357, 2526665, 2574149, 26095243, 30803551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	ORPHANET_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary amyloidosis	Amyloidosis	BEFREE	8435337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	18176868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	26116512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	1372840, 16044457, 16321848, 19141119, 21220604, 22035746, 22793267, 22917768, 23986553, 24190690, 24475114, 25232060, 25486952, 25520049, 26182311 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28188414, 28550473, 28782483, 30616601, 31485740, 31492993, 31559475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37176106, 37179366, 37270661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	28224300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	37730603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anaemia with excess blasts	Myelodysplastic syndrome	BEFREE	9078304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemia with ringed sideroblasts	Anemia With Ringed Sideroblasts	BEFREE	25899435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	37925496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	7669732, 8818656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28755662, 29628928, 31816725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	23441188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	31765478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	31521834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	12393503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	LHGDN	17768128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	17768128, 27039262	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	30223524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29073352, 35705251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	10025763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	17379062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Splanchnic vein thrombosis	Splanchnic vein thrombosis	BEFREE	25840747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	30223524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Syndactyly of the toes	Syndactyly Of The Toes	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	30223524		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	9639410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	LHGDN	14966468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	2098301, 22793267, 22847163, 23986553, 25486952, 26182311, 26754830, 26933174, 29134817, 29845291, 31340059, 8136288, 8689617, 8818385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	28437552, 29187020, 3455853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	Pubtator	28437552, 34477162, 36354705	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombotic Microangiopathies	Thrombotic Microangiopathies	BEFREE	30692122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	11474178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Truncus Arteriosus, Persistent	Persistent truncus arteriosus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	15866548		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	15866548		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Fibroids	Uterine Fibroids	BEFREE	7529547, 9740667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	28129744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	23473949, 26490317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum variant type	Xeroderma pigmentosum	Pubtator	15050919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum, Complementation Group D	Xeroderma Pigmentosum	BEFREE	24955348		★★★★★ ★☆☆☆☆ Found in Text Mining only

BCR (BCR activator of RhoGEF and GTPase)