Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6119
Gene name	Replication protein A3
Gene symbol	RPA3
Synonyms (NCBI Gene)	REPA3RP-A p14
Chromosome	7
Chromosome location	7p21.3

Show/Hide all (2)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029289	hsa-miR-26b-5p	Microarray	19088304
MIRT039841	hsa-miR-615-3p	CLASH	23622248

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000723	Process	Telomere maintenance	NAS	17959650
GO:0000723	Process	Telomere maintenance	TAS	24747047
GO:0000724	Process	Double-strand break repair via homologous recombination	IBA
GO:0000724	Process	Double-strand break repair via homologous recombination	IMP	17765923
GO:0000724	Process	Double-strand break repair via homologous recombination	NAS	17765923
GO:0003677	Function	DNA binding	IEA
GO:0003684	Function	Damaged DNA binding	IBA
GO:0003684	Function	Damaged DNA binding	IDA	7700386
GO:0003697	Function	Single-stranded DNA binding	IBA
GO:0003697	Function	Single-stranded DNA binding	IDA	19010961
GO:0005515	Function	Protein binding	IPI	2159011, 7760808, 10449415, 10982866, 11927569, 12527904, 15965237, 19338310, 20811460, 24126761, 24981860, 26496610, 28514442, 33961781, 34591612
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005662	Component	DNA replication factor A complex	IBA
GO:0005662	Component	DNA replication factor A complex	IDA	11927569
GO:0005662	Component	DNA replication factor A complex	IPI	7760808, 11927569
GO:0006260	Process	DNA replication	IBA
GO:0006260	Process	DNA replication	IEA
GO:0006260	Process	DNA replication	IMP	9430682
GO:0006260	Process	DNA replication	NAS	9430682
GO:0006281	Process	DNA repair	IDA	20545304
GO:0006281	Process	DNA repair	IEA
GO:0006284	Process	Base-excision repair	IBA
GO:0006284	Process	Base-excision repair	IDA	9765279
GO:0006289	Process	Nucleotide-excision repair	IBA
GO:0006289	Process	Nucleotide-excision repair	IMP	9430682
GO:0006289	Process	Nucleotide-excision repair	NAS	9430682
GO:0006298	Process	Mismatch repair	IBA
GO:0006298	Process	Mismatch repair	IMP	9430682
GO:0006310	Process	DNA recombination	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IEA
GO:0035861	Component	Site of double-strand break	IBA
GO:0042127	Process	Regulation of cell population proliferation	IEA

MIM	HGNC	e!Ensembl
179837	10291	ENSG00000106399

P35244

Protein name

Replication protein A 14 kDa subunit (RP-A p14) (Replication factor A protein 3) (RF-A protein 3)

Protein function

As part of the heterotrimeric replication protein A complex (RPA/RP-A), binds and stabilizes single-stranded DNA intermediates that form during DNA replication or upon DNA stress. It prevents their reannealing and in parallel, recruits and activ

PDB

1L1O , 1QUQ , 2PI2 , 2PQA , 2Z6K , 3KDF , 8RK2 , 9MJ5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08661	Rep_fac-A_3	5 → 113	Replication factor A protein 3	Domain

Sequence

MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLD
EEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQH
D

Sequence length

121

Interactions

View interactions

	KEGG		Reactome
	DNA replication Nucleotide excision repair Mismatch repair Homologous recombination Fanconi anemia pathway		Translesion synthesis by REV1 Recognition of DNA damage by PCNA-containing replication complex Translesion Synthesis by POLH Removal of the Flap Intermediate from the C-strand Activation of ATR in response to replication stress Regulation of HSF1-mediated heat shock response HSF1 activation Mismatch repair (MMR) directed by MSH2:MSH6 (MutSalpha) Mismatch repair (MMR) directed by MSH2:MSH3 (MutSbeta) PCNA-Dependent Long Patch Base Excision Repair Translesion synthesis by POLK Translesion synthesis by POLI Termination of translesion DNA synthesis HDR through Single Strand Annealing (SSA) HDR through Homologous Recombination (HRR) Processing of DNA double-strand break ends Presynaptic phase of homologous DNA pairing and strand exchange Formation of Incision Complex in GG-NER Gap-filling DNA repair synthesis and ligation in GG-NER Dual Incision in GG-NER Dual incision in TC-NER Gap-filling DNA repair synthesis and ligation in TC-NER Fanconi Anemia Pathway Regulation of TP53 Activity through Phosphorylation Activation of the pre-replicative complex Removal of the Flap Intermediate G2/M DNA damage checkpoint

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
INTERSTITIAL LUNG DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (21)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	33017027	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30462539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31300733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	31297992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35406779, 40642071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23573956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	27182645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28683444, 30462539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28766245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20520718	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	28681469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	40587682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28557284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28557284, 37858134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28766245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27706618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28557284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28557284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28766245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32862594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34269312	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RPA3 (replication protein A3)