Gene Gene information from NCBI Gene database.
Entrez ID 6103
Gene name Retinitis pigmentosa GTPase regulator
Gene symbol RPGR
Synonyms (NCBI Gene)
COD1CORDX1CRDPCDXRP15RP3XLRP3orf15
Chromosome X
Chromosome location Xp11.4
Summary This gene encodes a protein with a series of six RCC1-like domains (RLDs), characteristic of the highly conserved guanine nucleotide exchange factors. The encoded protein is found in the Golgi body and interacts with RPGRIP1. This protein localizes to the
SNPs SNP information provided by dbSNP.
122
SNP ID Visualize variation Clinical significance Consequence
rs62638627 C>G,T Not-provided, pathogenic Splice donor variant, genic upstream transcript variant, upstream transcript variant
rs62638632 T>C Pathogenic Splice acceptor variant
rs62638633 T>C Not-provided, pathogenic Splice acceptor variant
rs62638634 C>A Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs62638637 G>T Not-provided, pathogenic Coding sequence variant, non coding transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
28
miRTarBase ID miRNA Experiments Reference
MIRT019979 hsa-miR-375 Microarray 20215506
MIRT1315603 hsa-miR-1321 CLIP-seq
MIRT1315604 hsa-miR-134 CLIP-seq
MIRT1315605 hsa-miR-2909 CLIP-seq
MIRT1315606 hsa-miR-3118 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
38
GO ID Ontology Definition Evidence Reference
GO:0001750 Component Photoreceptor outer segment IBA
GO:0001750 Component Photoreceptor outer segment IDA 12140192
GO:0003723 Function RNA binding HDA 22658674
GO:0005085 Function Guanyl-nucleotide exchange factor activity IEA
GO:0005085 Function Guanyl-nucleotide exchange factor activity IMP 20631154
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
312610 10295 ENSG00000156313
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q92834
Protein name X-linked retinitis pigmentosa GTPase regulator
Protein function Acts as a guanine-nucleotide releasing factor (GEF) for RAB8A and RAB37 by promoting the conversion of inactive RAB-GDP to the active form RAB-GTP (PubMed:20631154). GEF activity towards RAB8A may facilitate ciliary trafficking by modulating cil
PDB 4JHN , 4JHP , 4QAM
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00415 RCC1 53 102 Regulator of chromosome condensation (RCC1) repeat Repeat
PF00415 RCC1 158 205 Regulator of chromosome condensation (RCC1) repeat Repeat
PF00415 RCC1 208 258 Regulator of chromosome condensation (RCC1) repeat Repeat
PF00415 RCC1 260 310 Regulator of chromosome condensation (RCC1) repeat Repeat
PF00415 RCC1 314 364 Regulator of chromosome condensation (RCC1) repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Heart, brain, placenta, lung, liver, muscle, kidney, retina, pancreas and fetal retinal pigment epithelium. Isoform 3 is found only in the retina. Colocalizes with RPGRIP1 in the outer segment of rod photoreceptors and cone outer segme
Sequence
MREPEELMPDSGAVFTFGKSKFAENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFG
SNNWGQLGLGSKSAISKPTCVKALKPEKVKLAACGRNHTLVS
TEGGNVYATGGNNEGQLG
LGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNV
CVPQQVTIGKPVSWISCGYYHSAFV
TTDGELYVFGEPENGKLGLPNQLLGNHRTPQLVSE
IPEKVIQVACGGEHTVVL
TENAVYTFGLGQFGQLGLGTFLFETSEPKVIENIRDQTISYI
SCGENHTALI
TDIGLMYTFGDGRHGKLGLGLENFTNHFIPTLCSNFLRFIVKLVACGGCH
MVVF
AAPHRGVAKEIEFDEINDTCLSVATFLPYSSLTSGNVLQRTLSARMRRRERERSPD
SFSMRRTLPPIEGTLGLSACFLPNSVFPRCSERNLQESVLSEQDLMQPEEPDYLLDEMTK
EAEIDNSSTVESLGETTDILNMTHIMSLNSNEKSLKLSPVQKQKKQQTIGELTQDTALTE
NDDSDEYEEMSEMKEGKACKQHVSQGIFMTQPATTIEAFSDEEVGNDTGQVGPQADTDGE
GLQKEVYRHENNNGVDQLDAKEIEKESDGGHSQKESEAEEIDSEKETKLAEIAGMKDLRE
REKSTKKMSPFFGNLPDRGMNTESEENKDFVKKRESCKQDVIFDSERESVEKPDSYMEGA
SESQQGIADGFQQPEAIEFSSGEKEDDEVETDQNIRYGRKLIEQGNEKETKPIISKSMAK
YDFKCDRLSEIPEEKEGAEDSKGNGIEEQEVEANEENVKVHGGRKEKTEILSDDLTDKAE
DHEFSKTEELKLEDVDEEINAENVESKKKTVGDDESVPTGYHSKTEGAERTNDDSSAETI
EKKEKANLEERAICEYNENPKGYMLDDADSSSLEILENSETTPSKDMKKTKKIFLFKRVP
SINQKIVKNNNEPLPEIKSIGDQIILKSDNKDADQNHMSQNHQNIPPTNTERRSKSCTIL
Sequence length 1020
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
55
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Cone dystrophy Pathogenic rs606231180, rs606231181 RCV001003190
RCV003324498
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cone dystrophy 1, X-linked Pathogenic rs606231180 RCV003151713
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cone-rod dystrophy Likely pathogenic; Pathogenic rs771214648, rs1601982595 RCV003883141
RCV000787708
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Congenital stationary night blindness Likely pathogenic rs1555966753 RCV000504795
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Achromatopsia Achromatopsia ORPHANET_DG
★☆☆☆☆
Found in Text Mining only
Achromatopsia Achromatopsia Orphanet
★☆☆☆☆
Found in Text Mining only
Age related macular degeneration Age-related macular degeneration BEFREE 12160730, 19429592, 31074760
★☆☆☆☆
Found in Text Mining only
Age related macular degeneration Age-related macular degeneration LHGDN 12160730
★☆☆☆☆
Found in Text Mining only
Age related macular degeneration Age-related macular degeneration CTD_human_DG 12160730
★☆☆☆☆
Found in Text Mining only
Age related macular degeneration Age-related macular degeneration HPO_DG
★☆☆☆☆
Found in Text Mining only
Amaurosis congenita of Leber type 1 Leber congenital amaurosis Pubtator 33712029 Associate
★☆☆☆☆
Found in Text Mining only
Amelogenesis Imperfecta Amelogenesis imperfecta BEFREE 12461695
★☆☆☆☆
Found in Text Mining only
Asthenozoospermia Asthenozoospermia HPO_DG
★☆☆☆☆
Found in Text Mining only
Asthma Asthma HPO_DG
★☆☆☆☆
Found in Text Mining only