Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6095
Gene name	RAR related orphan receptor A
Gene symbol	RORA
Synonyms (NCBI Gene)	IDDECANR1F1ROR1ROR2ROR3RORa1RORalphaRZR-ALPHARZRA
Chromosome	15
Chromosome location	15q22.2
Summary	The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The encoded protein

1045

Show/Hide all (1045)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017642	hsa-miR-335-5p	Microarray	18185580
MIRT020475	hsa-miR-106b-5p	Microarray	17242205
MIRT048959	hsa-miR-92a-3p	qRT-PCR	23622248
MIRT048959	hsa-miR-92a-3p	CLASH	23622248
MIRT054923	hsa-miR-33b-5p	Luciferase reporter assayqRT-PCR	23716591
MIRT437406	hsa-miR-137	Luciferase reporter assay	24500708
MIRT437406	hsa-miR-137	Luciferase reporter assay	24500708
MIRT437406	hsa-miR-137	Luciferase reporter assay	24500708
MIRT437406	hsa-miR-137	Luciferase reporter assay	24500708
MIRT437406	hsa-miR-137	Luciferase reporter assay	24500708
MIRT193668	hsa-miR-8485	HITS-CLIP	19536157
MIRT193667	hsa-miR-603	HITS-CLIP	19536157
MIRT612551	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT193537	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT193667	hsa-miR-603	HITS-CLIP	22927820
MIRT612551	hsa-miR-483-3p	HITS-CLIP	22927820
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	22927820
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	22927820
MIRT193537	hsa-miR-670-3p	HITS-CLIP	22927820
MIRT193668	hsa-miR-8485	HITS-CLIP	23313552
MIRT193667	hsa-miR-603	HITS-CLIP	23313552
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23313552
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23313552
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23313552
MIRT627687	hsa-miR-377-3p	HITS-CLIP	23313552
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23313552
MIRT193668	hsa-miR-8485	HITS-CLIP	23706177
MIRT627687	hsa-miR-377-3p	HITS-CLIP	23706177
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT627687	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT614799	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT614798	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT614797	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT614794	hsa-miR-4750-3p	HITS-CLIP	23824327
MIRT614793	hsa-miR-4725-5p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT627687	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT614799	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT614798	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT614797	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT614794	hsa-miR-4750-3p	HITS-CLIP	23824327
MIRT614793	hsa-miR-4725-5p	HITS-CLIP	23824327
MIRT627687	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT614799	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT614798	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT614797	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT654168	hsa-miR-622	HITS-CLIP	23824327
MIRT654167	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT380585	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT654166	hsa-miR-8086	HITS-CLIP	23824327
MIRT654165	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT654164	hsa-miR-449c-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT627687	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT614799	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT614798	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT614797	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT627687	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT614799	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT614798	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT614797	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT614794	hsa-miR-4750-3p	HITS-CLIP	23824327
MIRT614793	hsa-miR-4725-5p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT614799	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT614798	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT614797	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT614799	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT614798	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT614797	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT627687	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT614799	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT614798	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT614797	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT614796	hsa-miR-4690-3p	HITS-CLIP	23824327
MIRT614795	hsa-miR-5685	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT614794	hsa-miR-4750-3p	HITS-CLIP	23824327
MIRT614793	hsa-miR-4725-5p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT546707	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT193652	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT546704	hsa-miR-504-5p	PAR-CLIP	20371350
MIRT546703	hsa-miR-656-3p	PAR-CLIP	20371350
MIRT546702	hsa-miR-4641	PAR-CLIP	20371350
MIRT546701	hsa-miR-7848-3p	PAR-CLIP	20371350
MIRT193434	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT193437	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT546700	hsa-miR-2054	PAR-CLIP	20371350
MIRT546707	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT193652	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT546704	hsa-miR-504-5p	PAR-CLIP	20371350
MIRT546703	hsa-miR-656-3p	PAR-CLIP	20371350
MIRT546702	hsa-miR-4641	PAR-CLIP	20371350
MIRT546701	hsa-miR-7848-3p	PAR-CLIP	20371350
MIRT193434	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT193437	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT546700	hsa-miR-2054	PAR-CLIP	20371350
MIRT546707	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT546706	hsa-miR-10b-5p	PAR-CLIP	20371350
MIRT546705	hsa-miR-10a-5p	PAR-CLIP	20371350
MIRT193652	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT546704	hsa-miR-504-5p	PAR-CLIP	20371350
MIRT546703	hsa-miR-656-3p	PAR-CLIP	20371350
MIRT546702	hsa-miR-4641	PAR-CLIP	20371350
MIRT546701	hsa-miR-7848-3p	PAR-CLIP	20371350
MIRT193434	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT193437	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT546700	hsa-miR-2054	PAR-CLIP	20371350
MIRT193530	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT193529	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT020475	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT546699	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT546698	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT546697	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT546696	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT546695	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT546694	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT546693	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT546691	hsa-miR-4735-3p	PAR-CLIP	20371350
MIRT546692	hsa-miR-18b-5p	PAR-CLIP	20371350
MIRT546690	hsa-miR-18a-5p	PAR-CLIP	20371350
MIRT281614	hsa-miR-3662	PAR-CLIP	20371350
MIRT546689	hsa-miR-3133	PAR-CLIP	20371350
MIRT546688	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT546687	hsa-miR-3646	PAR-CLIP	20371350
MIRT193416	hsa-miR-1179	PAR-CLIP	20371350
MIRT546686	hsa-miR-33b-3p	PAR-CLIP	20371350
MIRT546685	hsa-miR-515-3p	PAR-CLIP	20371350
MIRT546684	hsa-miR-519e-3p	PAR-CLIP	20371350
MIRT193550	hsa-miR-4698	PAR-CLIP	20371350
MIRT546683	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT546682	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT546681	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT546680	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT546679	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT546678	hsa-miR-621	PAR-CLIP	20371350
MIRT565975	hsa-miR-4775	PAR-CLIP	20371350
MIRT193552	hsa-miR-548aw	PAR-CLIP	20371350
MIRT546707	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT546706	hsa-miR-10b-5p	PAR-CLIP	20371350
MIRT546705	hsa-miR-10a-5p	PAR-CLIP	20371350
MIRT193652	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT546704	hsa-miR-504-5p	PAR-CLIP	20371350
MIRT546703	hsa-miR-656-3p	PAR-CLIP	20371350
MIRT546702	hsa-miR-4641	PAR-CLIP	20371350
MIRT546701	hsa-miR-7848-3p	PAR-CLIP	20371350
MIRT193434	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT193437	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT546700	hsa-miR-2054	PAR-CLIP	20371350
MIRT546698	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT546694	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT546695	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT546697	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT546696	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT546699	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT546693	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT020475	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT193530	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT193529	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT546691	hsa-miR-4735-3p	PAR-CLIP	21572407
MIRT546692	hsa-miR-18b-5p	PAR-CLIP	21572407
MIRT546690	hsa-miR-18a-5p	PAR-CLIP	21572407
MIRT281614	hsa-miR-3662	PAR-CLIP	21572407
MIRT546689	hsa-miR-3133	PAR-CLIP	21572407
MIRT546688	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT546687	hsa-miR-3646	PAR-CLIP	21572407
MIRT546686	hsa-miR-33b-3p	PAR-CLIP	21572407
MIRT546685	hsa-miR-515-3p	PAR-CLIP	21572407
MIRT546684	hsa-miR-519e-3p	PAR-CLIP	21572407
MIRT193550	hsa-miR-4698	PAR-CLIP	21572407
MIRT546683	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT546682	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT546681	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT546680	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT546679	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT546678	hsa-miR-621	PAR-CLIP	21572407
MIRT193552	hsa-miR-548aw	PAR-CLIP	21572407
MIRT546707	hsa-miR-155-5p	PAR-CLIP	21572407
MIRT546706	hsa-miR-10b-5p	PAR-CLIP	21572407
MIRT546705	hsa-miR-10a-5p	PAR-CLIP	21572407
MIRT193652	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT546704	hsa-miR-504-5p	PAR-CLIP	21572407
MIRT546703	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT546702	hsa-miR-4641	PAR-CLIP	21572407
MIRT546701	hsa-miR-7848-3p	PAR-CLIP	21572407
MIRT193434	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT193437	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT546700	hsa-miR-2054	PAR-CLIP	21572407
MIRT020475	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT546699	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT546698	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT546697	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT546696	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT546695	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT546694	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT546693	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT193530	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT193529	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT546691	hsa-miR-4735-3p	PAR-CLIP	21572407
MIRT546692	hsa-miR-18b-5p	PAR-CLIP	21572407
MIRT546690	hsa-miR-18a-5p	PAR-CLIP	21572407
MIRT281614	hsa-miR-3662	PAR-CLIP	21572407
MIRT546689	hsa-miR-3133	PAR-CLIP	21572407
MIRT546688	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT546687	hsa-miR-3646	PAR-CLIP	21572407
MIRT193412	hsa-miR-32-3p	PAR-CLIP	21572407
MIRT193416	hsa-miR-1179	PAR-CLIP	21572407
MIRT546686	hsa-miR-33b-3p	PAR-CLIP	21572407
MIRT546685	hsa-miR-515-3p	PAR-CLIP	21572407
MIRT546684	hsa-miR-519e-3p	PAR-CLIP	21572407
MIRT193550	hsa-miR-4698	PAR-CLIP	21572407
MIRT546683	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT546682	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT546681	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT546680	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT546679	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT546678	hsa-miR-621	PAR-CLIP	21572407
MIRT193552	hsa-miR-548aw	PAR-CLIP	21572407
MIRT193652	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT542723	hsa-miR-300	PAR-CLIP	21572407
MIRT542722	hsa-miR-381-3p	PAR-CLIP	21572407
MIRT542721	hsa-miR-4666a-3p	PAR-CLIP	21572407
MIRT193655	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT193466	hsa-let-7a-3p	PAR-CLIP	21572407
MIRT193467	hsa-let-7b-3p	PAR-CLIP	21572407
MIRT193468	hsa-let-7f-1-3p	PAR-CLIP	21572407
MIRT193469	hsa-miR-98-3p	PAR-CLIP	21572407
MIRT193651	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT542719	hsa-miR-3924	PAR-CLIP	21572407
MIRT542720	hsa-miR-1277-3p	PAR-CLIP	21572407
MIRT542718	hsa-miR-4536-5p	PAR-CLIP	21572407
MIRT534604	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT534604	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT534603	hsa-miR-144-3p	PAR-CLIP	22012620
MIRT193527	hsa-miR-5580-3p	PAR-CLIP	22012620
MIRT534602	hsa-miR-8076	PAR-CLIP	22012620
MIRT534601	hsa-miR-1246	PAR-CLIP	22012620
MIRT386044	hsa-miR-506-5p	PAR-CLIP	22012620
MIRT534600	hsa-miR-873-5p	PAR-CLIP	22012620
MIRT193463	hsa-miR-1250-3p	PAR-CLIP	22012620
MIRT193461	hsa-miR-153-5p	PAR-CLIP	22012620
MIRT534599	hsa-miR-3171	PAR-CLIP	22012620
MIRT534598	hsa-miR-3167	PAR-CLIP	22012620
MIRT534597	hsa-miR-876-5p	PAR-CLIP	22012620
MIRT534596	hsa-miR-1290	PAR-CLIP	22012620
MIRT193442	hsa-let-7f-2-3p	PAR-CLIP	22012620
MIRT193445	hsa-miR-1185-1-3p	PAR-CLIP	22012620
MIRT193444	hsa-miR-1185-2-3p	PAR-CLIP	22012620
MIRT193507	hsa-miR-3611	PAR-CLIP	22012620
MIRT534595	hsa-miR-758-3p	PAR-CLIP	22012620
MIRT534594	hsa-miR-2113	PAR-CLIP	22012620
MIRT534593	hsa-miR-5010-3p	PAR-CLIP	22012620
MIRT193383	hsa-miR-129-5p	PAR-CLIP	22012620
MIRT450704	hsa-miR-7109-3p	PAR-CLIP	22100165
MIRT450703	hsa-miR-4453	PAR-CLIP	22100165
MIRT450702	hsa-miR-4538	PAR-CLIP	22100165
MIRT450701	hsa-miR-4781-3p	PAR-CLIP	22100165
MIRT450700	hsa-miR-4635	PAR-CLIP	22100165
MIRT450699	hsa-miR-4786-3p	PAR-CLIP	22100165
MIRT450697	hsa-miR-4668-5p	PAR-CLIP	22100165
MIRT450698	hsa-miR-3613-5p	PAR-CLIP	22100165
MIRT450696	hsa-miR-7843-3p	PAR-CLIP	22100165
MIRT450695	hsa-miR-127-5p	PAR-CLIP	22100165
MIRT439748	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439748	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	27418678
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	27418678
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	27418678
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	27418678
MIRT627687	hsa-miR-377-3p	HITS-CLIP	27418678
MIRT627687	hsa-miR-377-3p	HITS-CLIP	27418678
MIRT627687	hsa-miR-377-3p	HITS-CLIP	27418678
MIRT627687	hsa-miR-377-3p	HITS-CLIP	27418678
MIRT612551	hsa-miR-483-3p	HITS-CLIP	27418678
MIRT612551	hsa-miR-483-3p	HITS-CLIP	27418678
MIRT612551	hsa-miR-483-3p	HITS-CLIP	27418678
MIRT612551	hsa-miR-483-3p	HITS-CLIP	27418678
MIRT193667	hsa-miR-603	HITS-CLIP	27418678
MIRT193667	hsa-miR-603	HITS-CLIP	27418678
MIRT193667	hsa-miR-603	HITS-CLIP	27418678
MIRT193667	hsa-miR-603	HITS-CLIP	27418678
MIRT193537	hsa-miR-670-3p	HITS-CLIP	27418678
MIRT193537	hsa-miR-670-3p	HITS-CLIP	27418678
MIRT193537	hsa-miR-670-3p	HITS-CLIP	27418678
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	27418678
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	27418678
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	27418678
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	27418678
MIRT193668	hsa-miR-8485	HITS-CLIP	27418678
MIRT193668	hsa-miR-8485	HITS-CLIP	27418678
MIRT193668	hsa-miR-8485	HITS-CLIP	27418678
MIRT193668	hsa-miR-8485	HITS-CLIP	27418678
MIRT193668	hsa-miR-8485	HITS-CLIP	27418678
MIRT546705	hsa-miR-10a-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blotting	31832575
MIRT193668	hsa-miR-8485	HITS-CLIP	19536157
MIRT193667	hsa-miR-603	HITS-CLIP	19536157
MIRT612551	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT193537	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT193667	hsa-miR-603	HITS-CLIP	22927820
MIRT612551	hsa-miR-483-3p	HITS-CLIP	22927820
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	22927820
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	22927820
MIRT193537	hsa-miR-670-3p	HITS-CLIP	22927820
MIRT193668	hsa-miR-8485	HITS-CLIP	23313552
MIRT193667	hsa-miR-603	HITS-CLIP	23313552
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23313552
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23313552
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23313552
MIRT627687	hsa-miR-377-3p	HITS-CLIP	23313552
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23313552
MIRT193668	hsa-miR-8485	HITS-CLIP	23706177
MIRT627687	hsa-miR-377-3p	HITS-CLIP	23706177
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT627687	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT614799	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT614798	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT614797	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT614794	hsa-miR-4750-3p	HITS-CLIP	23824327
MIRT614793	hsa-miR-4725-5p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT627687	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT614799	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT614798	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT614797	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT614794	hsa-miR-4750-3p	HITS-CLIP	23824327
MIRT614793	hsa-miR-4725-5p	HITS-CLIP	23824327
MIRT627687	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT614799	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT614798	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT614797	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT654168	hsa-miR-622	HITS-CLIP	23824327
MIRT654167	hsa-miR-6870-3p	HITS-CLIP	23824327
MIRT380585	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT654166	hsa-miR-8086	HITS-CLIP	23824327
MIRT654165	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT654164	hsa-miR-449c-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT627687	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT614799	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT614798	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT614797	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT627687	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT614799	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT614798	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT614797	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT614794	hsa-miR-4750-3p	HITS-CLIP	23824327
MIRT614793	hsa-miR-4725-5p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT614799	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT614798	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT614797	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT614799	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT614798	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT614797	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT627687	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT614799	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT614798	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT614797	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT614796	hsa-miR-4690-3p	HITS-CLIP	23824327
MIRT614795	hsa-miR-5685	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT614794	hsa-miR-4750-3p	HITS-CLIP	23824327
MIRT614793	hsa-miR-4725-5p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT193668	hsa-miR-8485	HITS-CLIP	23824327
MIRT193667	hsa-miR-603	HITS-CLIP	23824327
MIRT612551	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT612550	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT612549	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT193537	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT546707	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT193652	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT546704	hsa-miR-504-5p	PAR-CLIP	20371350
MIRT546703	hsa-miR-656-3p	PAR-CLIP	20371350
MIRT546702	hsa-miR-4641	PAR-CLIP	20371350
MIRT546701	hsa-miR-7848-3p	PAR-CLIP	20371350
MIRT193434	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT193437	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT546700	hsa-miR-2054	PAR-CLIP	20371350
MIRT546707	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT193652	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT546704	hsa-miR-504-5p	PAR-CLIP	20371350
MIRT546703	hsa-miR-656-3p	PAR-CLIP	20371350
MIRT546702	hsa-miR-4641	PAR-CLIP	20371350
MIRT546701	hsa-miR-7848-3p	PAR-CLIP	20371350
MIRT193434	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT193437	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT546700	hsa-miR-2054	PAR-CLIP	20371350
MIRT546707	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT546706	hsa-miR-10b-5p	PAR-CLIP	20371350
MIRT546705	hsa-miR-10a-5p	PAR-CLIP	20371350
MIRT193652	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT546704	hsa-miR-504-5p	PAR-CLIP	20371350
MIRT546703	hsa-miR-656-3p	PAR-CLIP	20371350
MIRT546702	hsa-miR-4641	PAR-CLIP	20371350
MIRT546701	hsa-miR-7848-3p	PAR-CLIP	20371350
MIRT193434	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT193437	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT546700	hsa-miR-2054	PAR-CLIP	20371350
MIRT193530	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT193529	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT020475	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT546699	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT546698	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT546697	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT546696	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT546695	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT546694	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT546693	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT546691	hsa-miR-4735-3p	PAR-CLIP	20371350
MIRT546692	hsa-miR-18b-5p	PAR-CLIP	20371350
MIRT546690	hsa-miR-18a-5p	PAR-CLIP	20371350
MIRT281614	hsa-miR-3662	PAR-CLIP	20371350
MIRT546689	hsa-miR-3133	PAR-CLIP	20371350
MIRT546688	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT546687	hsa-miR-3646	PAR-CLIP	20371350
MIRT193416	hsa-miR-1179	PAR-CLIP	20371350
MIRT546686	hsa-miR-33b-3p	PAR-CLIP	20371350
MIRT546685	hsa-miR-515-3p	PAR-CLIP	20371350
MIRT546684	hsa-miR-519e-3p	PAR-CLIP	20371350
MIRT193550	hsa-miR-4698	PAR-CLIP	20371350
MIRT546683	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT546682	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT546681	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT546680	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT546679	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT546678	hsa-miR-621	PAR-CLIP	20371350
MIRT565975	hsa-miR-4775	PAR-CLIP	20371350
MIRT193552	hsa-miR-548aw	PAR-CLIP	20371350
MIRT546707	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT546706	hsa-miR-10b-5p	PAR-CLIP	20371350
MIRT546705	hsa-miR-10a-5p	PAR-CLIP	20371350
MIRT193652	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT546704	hsa-miR-504-5p	PAR-CLIP	20371350
MIRT546703	hsa-miR-656-3p	PAR-CLIP	20371350
MIRT546702	hsa-miR-4641	PAR-CLIP	20371350
MIRT546701	hsa-miR-7848-3p	PAR-CLIP	20371350
MIRT193434	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT193437	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT546700	hsa-miR-2054	PAR-CLIP	20371350
MIRT546698	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT546694	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT546695	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT546697	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT546696	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT546699	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT546693	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT020475	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT193530	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT193529	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT546691	hsa-miR-4735-3p	PAR-CLIP	21572407
MIRT546692	hsa-miR-18b-5p	PAR-CLIP	21572407
MIRT546690	hsa-miR-18a-5p	PAR-CLIP	21572407
MIRT281614	hsa-miR-3662	PAR-CLIP	21572407
MIRT546689	hsa-miR-3133	PAR-CLIP	21572407
MIRT546688	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT546687	hsa-miR-3646	PAR-CLIP	21572407
MIRT546686	hsa-miR-33b-3p	PAR-CLIP	21572407
MIRT546685	hsa-miR-515-3p	PAR-CLIP	21572407
MIRT546684	hsa-miR-519e-3p	PAR-CLIP	21572407
MIRT193550	hsa-miR-4698	PAR-CLIP	21572407
MIRT546683	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT546682	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT546681	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT546680	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT546679	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT546678	hsa-miR-621	PAR-CLIP	21572407
MIRT193552	hsa-miR-548aw	PAR-CLIP	21572407
MIRT546707	hsa-miR-155-5p	PAR-CLIP	21572407
MIRT546706	hsa-miR-10b-5p	PAR-CLIP	21572407
MIRT546705	hsa-miR-10a-5p	PAR-CLIP	21572407
MIRT193652	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT546704	hsa-miR-504-5p	PAR-CLIP	21572407
MIRT546703	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT546702	hsa-miR-4641	PAR-CLIP	21572407
MIRT546701	hsa-miR-7848-3p	PAR-CLIP	21572407
MIRT193434	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT193437	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT546700	hsa-miR-2054	PAR-CLIP	21572407
MIRT020475	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT546699	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT546698	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT546697	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT546696	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT546695	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT546694	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT546693	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT193530	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT193529	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT546691	hsa-miR-4735-3p	PAR-CLIP	21572407
MIRT546692	hsa-miR-18b-5p	PAR-CLIP	21572407
MIRT546690	hsa-miR-18a-5p	PAR-CLIP	21572407
MIRT281614	hsa-miR-3662	PAR-CLIP	21572407
MIRT546689	hsa-miR-3133	PAR-CLIP	21572407
MIRT546688	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT546687	hsa-miR-3646	PAR-CLIP	21572407
MIRT193412	hsa-miR-32-3p	PAR-CLIP	21572407
MIRT193416	hsa-miR-1179	PAR-CLIP	21572407
MIRT546686	hsa-miR-33b-3p	PAR-CLIP	21572407
MIRT546685	hsa-miR-515-3p	PAR-CLIP	21572407
MIRT546684	hsa-miR-519e-3p	PAR-CLIP	21572407
MIRT193550	hsa-miR-4698	PAR-CLIP	21572407
MIRT546683	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT546682	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT546681	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT546680	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT546679	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT546678	hsa-miR-621	PAR-CLIP	21572407
MIRT193552	hsa-miR-548aw	PAR-CLIP	21572407
MIRT193652	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT542723	hsa-miR-300	PAR-CLIP	21572407
MIRT542722	hsa-miR-381-3p	PAR-CLIP	21572407
MIRT542721	hsa-miR-4666a-3p	PAR-CLIP	21572407
MIRT193655	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT193466	hsa-let-7a-3p	PAR-CLIP	21572407
MIRT193467	hsa-let-7b-3p	PAR-CLIP	21572407
MIRT193468	hsa-let-7f-1-3p	PAR-CLIP	21572407
MIRT193469	hsa-miR-98-3p	PAR-CLIP	21572407
MIRT193651	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT542719	hsa-miR-3924	PAR-CLIP	21572407
MIRT542720	hsa-miR-1277-3p	PAR-CLIP	21572407
MIRT542718	hsa-miR-4536-5p	PAR-CLIP	21572407
MIRT534604	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT534604	hsa-miR-101-3p	PAR-CLIP	22012620
MIRT534603	hsa-miR-144-3p	PAR-CLIP	22012620
MIRT193527	hsa-miR-5580-3p	PAR-CLIP	22012620
MIRT534602	hsa-miR-8076	PAR-CLIP	22012620
MIRT534601	hsa-miR-1246	PAR-CLIP	22012620
MIRT386044	hsa-miR-506-5p	PAR-CLIP	22012620
MIRT534600	hsa-miR-873-5p	PAR-CLIP	22012620
MIRT193463	hsa-miR-1250-3p	PAR-CLIP	22012620
MIRT193461	hsa-miR-153-5p	PAR-CLIP	22012620
MIRT534599	hsa-miR-3171	PAR-CLIP	22012620
MIRT534598	hsa-miR-3167	PAR-CLIP	22012620
MIRT534597	hsa-miR-876-5p	PAR-CLIP	22012620
MIRT534596	hsa-miR-1290	PAR-CLIP	22012620
MIRT193442	hsa-let-7f-2-3p	PAR-CLIP	22012620
MIRT193445	hsa-miR-1185-1-3p	PAR-CLIP	22012620
MIRT193444	hsa-miR-1185-2-3p	PAR-CLIP	22012620
MIRT193507	hsa-miR-3611	PAR-CLIP	22012620
MIRT534595	hsa-miR-758-3p	PAR-CLIP	22012620
MIRT534594	hsa-miR-2113	PAR-CLIP	22012620
MIRT534593	hsa-miR-5010-3p	PAR-CLIP	22012620
MIRT193383	hsa-miR-129-5p	PAR-CLIP	22012620
MIRT450704	hsa-miR-7109-3p	PAR-CLIP	22100165
MIRT450703	hsa-miR-4453	PAR-CLIP	22100165
MIRT450702	hsa-miR-4538	PAR-CLIP	22100165
MIRT450701	hsa-miR-4781-3p	PAR-CLIP	22100165
MIRT450700	hsa-miR-4635	PAR-CLIP	22100165
MIRT450699	hsa-miR-4786-3p	PAR-CLIP	22100165
MIRT450697	hsa-miR-4668-5p	PAR-CLIP	22100165
MIRT450698	hsa-miR-3613-5p	PAR-CLIP	22100165
MIRT450696	hsa-miR-7843-3p	PAR-CLIP	22100165
MIRT450695	hsa-miR-127-5p	PAR-CLIP	22100165
MIRT1315166	hsa-miR-1279	CLIP-seq
MIRT1315167	hsa-miR-128	CLIP-seq
MIRT1315168	hsa-miR-155	CLIP-seq
MIRT1315169	hsa-miR-219-5p	CLIP-seq
MIRT1315170	hsa-miR-224	CLIP-seq
MIRT1315171	hsa-miR-23a	CLIP-seq
MIRT1315172	hsa-miR-23b	CLIP-seq
MIRT1315173	hsa-miR-23c	CLIP-seq
MIRT1315174	hsa-miR-27a	CLIP-seq
MIRT1315175	hsa-miR-27b	CLIP-seq
MIRT1315176	hsa-miR-3134	CLIP-seq
MIRT1315177	hsa-miR-3668	CLIP-seq
MIRT1315178	hsa-miR-377	CLIP-seq
MIRT1315179	hsa-miR-4282	CLIP-seq
MIRT1315180	hsa-miR-4320	CLIP-seq
MIRT1315181	hsa-miR-4426	CLIP-seq
MIRT1315182	hsa-miR-4432	CLIP-seq
MIRT1315183	hsa-miR-4517	CLIP-seq
MIRT1315184	hsa-miR-4647	CLIP-seq
MIRT1315185	hsa-miR-4662b	CLIP-seq
MIRT1315186	hsa-miR-4676-5p	CLIP-seq
MIRT1315187	hsa-miR-4768-3p	CLIP-seq
MIRT1315188	hsa-miR-4777-5p	CLIP-seq
MIRT1315189	hsa-miR-4782-3p	CLIP-seq
MIRT1315190	hsa-miR-4793-5p	CLIP-seq
MIRT1315191	hsa-miR-487a	CLIP-seq
MIRT1315192	hsa-miR-499-5p	CLIP-seq
MIRT1315193	hsa-miR-501-5p	CLIP-seq
MIRT1315194	hsa-miR-5096	CLIP-seq
MIRT1315195	hsa-miR-513a-5p	CLIP-seq
MIRT1315196	hsa-miR-513c	CLIP-seq
MIRT1315197	hsa-miR-514b-5p	CLIP-seq
MIRT1315198	hsa-miR-518a-5p	CLIP-seq
MIRT1315199	hsa-miR-518d-5p	CLIP-seq
MIRT1315200	hsa-miR-519b-5p	CLIP-seq
MIRT1315201	hsa-miR-519c-5p	CLIP-seq
MIRT1315202	hsa-miR-520c-5p	CLIP-seq
MIRT1315203	hsa-miR-526a	CLIP-seq
MIRT1315204	hsa-miR-527	CLIP-seq
MIRT1315205	hsa-miR-548a-5p	CLIP-seq
MIRT1315206	hsa-miR-548ab	CLIP-seq
MIRT1315207	hsa-miR-548ak	CLIP-seq
MIRT1315208	hsa-miR-548b-5p	CLIP-seq
MIRT1315209	hsa-miR-548c-5p	CLIP-seq
MIRT1315210	hsa-miR-548d-5p	CLIP-seq
MIRT1315211	hsa-miR-548h	CLIP-seq
MIRT1315212	hsa-miR-548i	CLIP-seq
MIRT1315213	hsa-miR-548j	CLIP-seq
MIRT1315214	hsa-miR-548k	CLIP-seq
MIRT1315215	hsa-miR-548l	CLIP-seq
MIRT1315216	hsa-miR-548w	CLIP-seq
MIRT1315217	hsa-miR-548y	CLIP-seq
MIRT1315218	hsa-miR-559	CLIP-seq
MIRT1315219	hsa-miR-561	CLIP-seq
MIRT1315220	hsa-miR-575	CLIP-seq
MIRT1315221	hsa-miR-616	CLIP-seq
MIRT1315222	hsa-miR-664	CLIP-seq
MIRT1315223	hsa-miR-873	CLIP-seq
MIRT1315224	hsa-miR-889	CLIP-seq
MIRT1315225	hsa-miR-1252	CLIP-seq
MIRT1315226	hsa-miR-1263	CLIP-seq
MIRT1315227	hsa-miR-1324	CLIP-seq
MIRT1315228	hsa-miR-219-2-3p	CLIP-seq
MIRT1315229	hsa-miR-3121-5p	CLIP-seq
MIRT1315230	hsa-miR-3152-5p	CLIP-seq
MIRT1315231	hsa-miR-3613-3p	CLIP-seq
MIRT1315232	hsa-miR-362-5p	CLIP-seq
MIRT1315233	hsa-miR-4539	CLIP-seq
MIRT1315234	hsa-miR-4705	CLIP-seq
MIRT1315235	hsa-miR-4724-5p	CLIP-seq
MIRT1315236	hsa-miR-4774-3p	CLIP-seq
MIRT1315237	hsa-miR-500b	CLIP-seq
MIRT1315193	hsa-miR-501-5p	CLIP-seq
MIRT1315238	hsa-miR-548aa	CLIP-seq
MIRT1315239	hsa-miR-548m	CLIP-seq
MIRT1315240	hsa-miR-587	CLIP-seq
MIRT1315241	hsa-miR-600	CLIP-seq
MIRT1315242	hsa-miR-1299	CLIP-seq
MIRT1315243	hsa-miR-3121-3p	CLIP-seq
MIRT1315244	hsa-miR-3155	CLIP-seq
MIRT1315245	hsa-miR-3155b	CLIP-seq
MIRT1315180	hsa-miR-4320	CLIP-seq
MIRT1315246	hsa-miR-4782-5p	CLIP-seq
MIRT1315247	hsa-miR-484	CLIP-seq
MIRT1315248	hsa-miR-516b	CLIP-seq
MIRT1315249	hsa-miR-654-3p	CLIP-seq
MIRT1553173	hsa-miR-3679-3p	CLIP-seq
MIRT1315168	hsa-miR-155	CLIP-seq
MIRT2093765	hsa-miR-1322	CLIP-seq
MIRT2093766	hsa-miR-138	CLIP-seq
MIRT1315170	hsa-miR-224	CLIP-seq
MIRT2093767	hsa-miR-3123	CLIP-seq
MIRT2093768	hsa-miR-340	CLIP-seq
MIRT2093769	hsa-miR-4275	CLIP-seq
MIRT2093770	hsa-miR-4666-3p	CLIP-seq
MIRT2093771	hsa-miR-4719	CLIP-seq
MIRT2093772	hsa-miR-4731-3p	CLIP-seq
MIRT2093773	hsa-miR-4755-5p	CLIP-seq
MIRT2093774	hsa-miR-4761-5p	CLIP-seq
MIRT2093775	hsa-miR-4801	CLIP-seq
MIRT2093776	hsa-miR-490-5p	CLIP-seq
MIRT2093777	hsa-miR-502-5p	CLIP-seq
MIRT1315194	hsa-miR-5096	CLIP-seq
MIRT1315240	hsa-miR-587	CLIP-seq
MIRT2093778	hsa-miR-759	CLIP-seq
MIRT2318170	hsa-miR-3166	CLIP-seq
MIRT2318171	hsa-miR-3622b-5p	CLIP-seq
MIRT2318172	hsa-miR-4272	CLIP-seq
MIRT2318173	hsa-miR-648	CLIP-seq
MIRT1315227	hsa-miR-1324	CLIP-seq
MIRT2318174	hsa-miR-3065-5p	CLIP-seq
MIRT2318175	hsa-miR-3154	CLIP-seq
MIRT2318176	hsa-miR-3185	CLIP-seq
MIRT2318177	hsa-miR-3688-3p	CLIP-seq
MIRT2318178	hsa-miR-4277	CLIP-seq
MIRT2318179	hsa-miR-4699-3p	CLIP-seq
MIRT1315194	hsa-miR-5096	CLIP-seq
MIRT2318180	hsa-miR-548ag	CLIP-seq
MIRT2318181	hsa-miR-548ai	CLIP-seq
MIRT1315239	hsa-miR-548m	CLIP-seq
MIRT1315180	hsa-miR-4320	CLIP-seq
MIRT1315187	hsa-miR-4768-3p	CLIP-seq
MIRT1315223	hsa-miR-873	CLIP-seq
MIRT2613977	hsa-miR-1237	CLIP-seq
MIRT2613978	hsa-miR-1248	CLIP-seq
MIRT2613979	hsa-miR-1273g	CLIP-seq
MIRT2613980	hsa-miR-136	CLIP-seq
MIRT2613981	hsa-miR-142-5p	CLIP-seq
MIRT2613982	hsa-miR-183	CLIP-seq
MIRT2613983	hsa-miR-186	CLIP-seq
MIRT1315170	hsa-miR-224	CLIP-seq
MIRT2613984	hsa-miR-2467-3p	CLIP-seq
MIRT2613985	hsa-miR-302a	CLIP-seq
MIRT2613986	hsa-miR-302b	CLIP-seq
MIRT2613987	hsa-miR-302c	CLIP-seq
MIRT2613988	hsa-miR-302d	CLIP-seq
MIRT2613989	hsa-miR-302e	CLIP-seq
MIRT2613990	hsa-miR-3125	CLIP-seq
MIRT2613991	hsa-miR-3136-3p	CLIP-seq
MIRT2613992	hsa-miR-3150b-3p	CLIP-seq
MIRT2613993	hsa-miR-3153	CLIP-seq
MIRT2318170	hsa-miR-3166	CLIP-seq
MIRT2613994	hsa-miR-3192	CLIP-seq
MIRT2613995	hsa-miR-3194-3p	CLIP-seq
MIRT2613996	hsa-miR-326	CLIP-seq
MIRT2613997	hsa-miR-329	CLIP-seq
MIRT2613998	hsa-miR-330-5p	CLIP-seq
MIRT2093768	hsa-miR-340	CLIP-seq
MIRT2613999	hsa-miR-3607-5p	CLIP-seq
MIRT2614000	hsa-miR-3616-5p	CLIP-seq
MIRT2614001	hsa-miR-362-3p	CLIP-seq
MIRT2614002	hsa-miR-3647-5p	CLIP-seq
MIRT2614003	hsa-miR-3674	CLIP-seq
MIRT2614004	hsa-miR-372	CLIP-seq
MIRT2614005	hsa-miR-373	CLIP-seq
MIRT2614006	hsa-miR-3916	CLIP-seq
MIRT2614007	hsa-miR-3941	CLIP-seq
MIRT2614008	hsa-miR-3944-5p	CLIP-seq
MIRT2614009	hsa-miR-4266	CLIP-seq
MIRT2614010	hsa-miR-4289	CLIP-seq
MIRT2614011	hsa-miR-4310	CLIP-seq
MIRT2614012	hsa-miR-4314	CLIP-seq
MIRT2614013	hsa-miR-4519	CLIP-seq
MIRT2614014	hsa-miR-4645-3p	CLIP-seq
MIRT2614015	hsa-miR-4646-5p	CLIP-seq
MIRT2614016	hsa-miR-4695-5p	CLIP-seq
MIRT2614017	hsa-miR-4711-3p	CLIP-seq
MIRT2614018	hsa-miR-4716-5p	CLIP-seq
MIRT2614019	hsa-miR-4727-5p	CLIP-seq
MIRT2614020	hsa-miR-4732-5p	CLIP-seq
MIRT2614021	hsa-miR-4747-5p	CLIP-seq
MIRT2614022	hsa-miR-4771	CLIP-seq
MIRT2614023	hsa-miR-4778-5p	CLIP-seq
MIRT2614024	hsa-miR-4779	CLIP-seq
MIRT2614025	hsa-miR-4784	CLIP-seq
MIRT2614026	hsa-miR-4795-5p	CLIP-seq
MIRT2614027	hsa-miR-4797-5p	CLIP-seq
MIRT2614028	hsa-miR-494	CLIP-seq
MIRT2614029	hsa-miR-495	CLIP-seq
MIRT2614030	hsa-miR-500a	CLIP-seq
MIRT2614031	hsa-miR-504	CLIP-seq
MIRT2614032	hsa-miR-510	CLIP-seq
MIRT2614033	hsa-miR-513a-3p	CLIP-seq
MIRT2614034	hsa-miR-520a-3p	CLIP-seq
MIRT2614035	hsa-miR-520b	CLIP-seq
MIRT2614036	hsa-miR-520c-3p	CLIP-seq
MIRT2614037	hsa-miR-520d-3p	CLIP-seq
MIRT2614038	hsa-miR-520e	CLIP-seq
MIRT2614039	hsa-miR-548u	CLIP-seq
MIRT2614040	hsa-miR-573	CLIP-seq
MIRT2614041	hsa-miR-574-3p	CLIP-seq
MIRT2614042	hsa-miR-582-3p	CLIP-seq
MIRT2614043	hsa-miR-671-5p	CLIP-seq
MIRT2093778	hsa-miR-759	CLIP-seq
MIRT2614044	hsa-miR-877	CLIP-seq
MIRT2613977	hsa-miR-1237	CLIP-seq
MIRT2613978	hsa-miR-1248	CLIP-seq
MIRT2613980	hsa-miR-136	CLIP-seq
MIRT2613982	hsa-miR-183	CLIP-seq
MIRT2613984	hsa-miR-2467-3p	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
HIF1A	Activation	14742449
SP1	Activation	14742449
SP3	Activation	14742449

Show/Hide all (82)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	19955433
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	21628546
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001221	Function	Transcription coregulator binding	IPI	14701856
GO:0001222	Function	Transcription corepressor binding	IPI	9328355
GO:0001223	Function	Transcription coactivator binding	IEA
GO:0001223	Function	Transcription coactivator binding	IPI	9862959, 10478845
GO:0001525	Process	Angiogenesis	IMP	18658046
GO:0003677	Function	DNA binding	IDA	7926749, 9328355, 11053433
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	7926749, 9328355, 11053433, 17545671, 18658046
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	9862959, 16713569, 18354202, 18658046, 22170608, 25416956
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	18658046, 19965867
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	9328355
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006805	Process	Xenobiotic metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	ISS
GO:0006809	Process	Nitric oxide biosynthetic process	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0008013	Function	Beta-catenin binding	IEA
GO:0008142	Function	Oxysterol binding	IBA
GO:0008142	Function	Oxysterol binding	IDA	19965867
GO:0008270	Function	Zinc ion binding	IEA
GO:0008589	Process	Regulation of smoothened signaling pathway	IEA
GO:0008589	Process	Regulation of smoothened signaling pathway	ISS
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IMP	18658046
GO:0010906	Process	Regulation of glucose metabolic process	IEA
GO:0010906	Process	Regulation of glucose metabolic process	ISS
GO:0019218	Process	Regulation of steroid metabolic process	IEA
GO:0019218	Process	Regulation of steroid metabolic process	ISS
GO:0021702	Process	Cerebellar Purkinje cell differentiation	IEA
GO:0021930	Process	Cerebellar granule cell precursor proliferation	IEA
GO:0021930	Process	Cerebellar granule cell precursor proliferation	ISS
GO:0030522	Process	Intracellular receptor signaling pathway	IDA	19965867
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0036315	Process	Cellular response to sterol	IDA	19965867
GO:0036315	Process	Cellular response to sterol	IMP	18658046
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0042692	Process	Muscle cell differentiation	IMP	9862959
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042753	Process	Positive regulation of circadian rhythm	IEA
GO:0042753	Process	Positive regulation of circadian rhythm	ISS
GO:0043030	Process	Regulation of macrophage activation	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IMP	11252722
GO:0043565	Function	Sequence-specific DNA binding	IDA	11053433
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	7926749
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	17545671, 19955433
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046068	Process	CGMP metabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IBA
GO:0050728	Process	Negative regulation of inflammatory response	IMP	11252722
GO:0070328	Process	Triglyceride homeostasis	IEA
GO:0070328	Process	Triglyceride homeostasis	IMP	11053433
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071456	Process	Cellular response to hypoxia	IMP	18658046
GO:0072539	Process	T-helper 17 cell differentiation	IEA
GO:0098531	Function	Ligand-modulated transcription factor activity	IDA	19965867

MIM	HGNC	e!Ensembl
600825	10258	ENSG00000069667

P35398

Protein name

Nuclear receptor ROR-alpha (Nuclear receptor RZR-alpha) (Nuclear receptor subfamily 1 group F member 1) (RAR-related orphan receptor A) (Retinoid-related orphan receptor-alpha)

Protein function

Nuclear receptor that binds DNA as a monomer to ROR response elements (RORE) containing a single core motif half-site 5'-AGGTCA-3' preceded by a short A-T-rich sequence. Key regulator of embryonic development, cellular differentiation, immunity,

PDB

1N83 , 1S0X , 4S15

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00105	zf-C4	71 → 140	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	305 → 494	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed in a number of tissues. Expressed in both regulatory T-cells (Treg) and effector T-cells (Teff) (PubMed:18354202, PubMed:7916608). Isoform 4: Highly expressed in the central nervous system, including in the cerebellum

Sequence

MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPVRRQSYSSTSRGISVT
KKTHTSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRT
SRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAE
PLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIK
PEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHLETCQYLREELQQITW
QTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGS
LEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEI
ALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRAL
CGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG

Sequence length

523

Interactions

View interactions

	KEGG		Reactome
	Th17 cell differentiation Circadian rhythm Spinocerebellar ataxia Inflammatory bowel disease		RORA activates gene expression PPARA activates gene expression Nuclear Receptor transcription pathway Circadian Clock SUMOylation of intracellular receptors Interleukin-4 and Interleukin-13 signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Intellectual developmental disorder with or without epilepsy or cerebellar ataxia	Likely pathogenic; Pathogenic	rs2141286878, rs2542193929, rs2541994504, rs2541966112, rs2542073001, rs2542051635, rs2542049088, rs2542051691, rs2541965807, rs1057518981, rs1555423812, rs1555427498, rs1555427497, rs1595874995, rs1595889010, rs1595874842 View all (1 more)	RCV001650476 RCV003123340 RCV003148589 RCV003226882 RCV003314171 View all (11 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neurodevelopmental disorder	Likely pathogenic	rs2141286330	RCV001375024	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Severe intellectual deficiency	Likely pathogenic; Pathogenic	rs1057518981	RCV000415103	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (56)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC CENTRAL SEROUS RETINOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FUCHS ENDOTHELIAL CORNEAL DYSTROPHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATOCONUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RORA-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL AFFECTIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (405)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Accessory kidney	Accessory Kidney	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	18354269, 22988987, 23153538, 23285131, 30631148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	28613211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	22104449, 23771907, 28465645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23593420, 25978653, 27852699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	27440078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18354269, 22988987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	23278988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	21060049, 21998696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	GWASCAT_DG	30013184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	31340215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	GWASCAT_DG	28196072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Extrinsic allergic alveolitis	Pubtator	32951408	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	31283791	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	26196693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankyloglossia	Ankyloglossia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
ANONYCHIA	Anonychia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26259918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29073752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27925372, 30957191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	31636631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	25430993, 26359667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis multiplex congenita	CLINVAR_DG	31680123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASCAT_DG	20860503, 27130862, 27182965, 29273806, 30552067, 30787307, 30929738, 31619474		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASDB_DG	20860503, 21907864, 22561531		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	23028483, 24260339, 25863981	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	29282706, 30539779		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	15781255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27925372, 30957191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	24500708	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorder	Autism	Pubtator	37673435	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	26625251, 28608249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic behavior	Autism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	20375269, 21359227		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	20375269	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	21359227, 24204716, 24500708, 25668517, 29423132, 37108679	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	29656859		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30189901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal recessive non-syndromic sensorineural deafness type DFNB	Non-Syndromic Sensorineural Deafness	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal recessive Robinow syndrome	Robinow Syndrome	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	40215689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	18354269, 18604725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal Cell Neoplasm	BEFREE	12548386, 17632781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	30251751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	19488044, 21494683, 25789810, 25989161, 30178121	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	20072116, 21494683, 22538398, 24150227, 24716566		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	22538398, 24716566, 25789810, 30178121		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blast Crisis	Blast crisis	Pubtator	33836616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	21480365, 22781592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	BEFREE	12011143, 17632781, 18353862, 19640924, 21693067, 31798639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	Pubtator	21693067, 36064339	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly syndrome type B	Brachydactyly	ORPHANET_DG	10700182, 10986040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly Type B1	Brachydactyly	Pubtator	10986040, 17668388, 36064339	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly type B1	Brachydactyly	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
BRACHYDACTYLY, TYPE B1	Brachydactyly	BEFREE	10932186, 10932187, 10986040, 11932993, 17061261, 17665217, 18353862, 19146779, 19236432, 19461659, 19530173, 19640924, 23142633, 24954533, 28236965, 30801848 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
BRACHYDACTYLY, TYPE B1	Brachydactyly	GENOMICS_ENGLAND_DG	19461659, 19533773		★★★★★ ★☆☆☆☆ Found in Text Mining only
BRACHYDACTYLY, TYPE B1	Brachydactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
BRACHYDACTYLY, TYPE B1	Brachydactyly	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
BRACHYDACTYLY, TYPE B1	Brachydactyly	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
BRACHYDACTYLY, TYPE B2 (disorder)	Brachydactyly	BEFREE	24954533, 28523267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	22403610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23593420, 23771907, 24919398, 26874851, 28114269, 28177907, 28695110, 29455641, 29774072, 29904382, 30622177, 31085100, 31358835, 31364167, 31415244		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	28114269		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	19439415, 21167036, 23443091, 23593420, 25209439, 28598825, 31085100, 31358835, 32020017, 34911552, 35605663, 36001375, 37029329, 39193850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28052040	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21818335	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22293903, 24158497, 36359790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19448672, 24158497, 26739507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	27852699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21818335, 30637779, 31746401, 34745328, 36114756, 37814183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22493546, 24798975	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18215320, 29455641, 31174180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26515598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28475014	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26259918, 34565024, 34763666, 37096681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	20185829, 23893409, 33804101, 35812454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23922987	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35603384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26515598, 26575700, 27852699, 28342318, 28475014, 28536612, 29348860, 31008116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	28454387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	37542143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	27925372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar atrophy	Cerebellar atrophy	BEFREE	16539693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar diseases	Pubtator	39707840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	18354269, 22988987, 23285131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	30929738, 31036433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	23278988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	LHGDN	16632463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	18223214, 18287027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18287027, 18354269, 18546292, 18604725, 20686606, 20813009, 21481194, 21813176, 22988987, 23593420, 24205204, 26690702, 27086035, 27815263, 27904138 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	24943193, 30355907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic otitis media	Otitis media	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	32892507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	22490406, 34061439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	22490406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	22490406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly	Clinodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly of the 5th finger	Camptodactyly of fingers	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	28412756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21305677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16211313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	28557546, 35116071	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36704936	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27301432, 27440078, 27631337, 29395309, 29968159, 30907503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20122401, 20591152, 27301432, 28427197, 29453334, 30907503, 31486489, 31693094, 32096171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27440078	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	29968159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	23043388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital absence of uvula	Absent uvula	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Camptodactyly	Congenital Camptodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital coloboma of iris	Congenital Coloboma Of Iris	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital exomphalos	Congenital Exomphalos	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital fusion of ribs	Rib fusion	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hand Deformities	Congenital anomaly of the hand	BEFREE	30143665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	26035863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of penis	Congenital Hypoplasia Of Penis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital pectus carinatum	Congenital Pectus Carinatum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital sensorineural hearing loss	Congenital Sensorineural Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19448672, 20185829, 25542006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	35934844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	35344616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing's symphalangism	Proximal symphalangism	Pubtator	17668388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	29313974		★★★★★ ★☆☆☆☆ Found in Text Mining only
DEAFNESS, AUTOSOMAL RECESSIVE 108	Deafness	GENOMICS_ENGLAND_DG	27162350		★★★★★ ★☆☆☆☆ Found in Text Mining only
DEAFNESS, AUTOSOMAL RECESSIVE 108	Deafness	UNIPROT_DG	27162350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Defect of vertebral segmentation	Abnormal spinal segmentation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	22057548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	19693801, 20800221, 22538398, 29073752		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	19693801, 20800221, 22538398		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	25668517	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	31226136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	23922987, 28774591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	39707840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21090593	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	29194733	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	22988987, 30801854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	LHGDN	15781255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectopia Lentis	Ectopia lentis	Pubtator	24940037	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectopic anus	Ectopic anus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	31226136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	21061152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29395309, 30093563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32170852, 32807831, 34115460, 36708573, 37241228	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	25668517, 29656859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	25668517, 39707840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Generalized	Generalized epilepsy	Pubtator	39707840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	26515598, 28342318, 29348860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	27852699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32503923	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esotropia	Esotropia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	26173023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	21060049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eyelid Diseases	Eyelid disease	Pubtator	39707840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29167529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	22294416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	26173023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fingernail dysplasia	Fingernail dysplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontal bossing	Frontal bossing	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	22294416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	34646884	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	BEFREE	25301448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36314076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25301448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28177907		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	34479497, 36314076	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	19786043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	35344616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	28690889	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	29884837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	29884837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	32951408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Ventricular	Congenital heart septal defect	Pubtator	10986040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	22988987, 25978653, 28328317, 29989208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	25978653, 28328317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobin SC Disease	Hemoglobin sc disease	Pubtator	28465645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	20702778	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperalgesia	Hyperalgesia	Pubtator	35040478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperostosis Diffuse Idiopathic Skeletal	Diffuse idiopathic skeletal hyperostosis	Pubtator	37156767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	Pubtator	25550791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	9564842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	11821045, 36314076	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31287590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33174051	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	32951408, 33925174	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	11252722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	23771907		★★★★★ ★☆☆☆☆ Found in Text Mining only
INTELLECTUAL DEVELOPMENTAL DISORDER WITH OR WITHOUT EPILEPSY OR CEREBELLAR ATAXIA	Intellectual Developmental Disorder With Or Without Epilepsy Or Cerebellar Ataxia	UNIPROT_DG	29656859		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
INTELLECTUAL DEVELOPMENTAL DISORDER WITH OR WITHOUT EPILEPSY OR CEREBELLAR ATAXIA	Intellectual Developmental Disorder With Or Without Epilepsy Or Cerebellar Ataxia	GENOMICS_ENGLAND_DG	29656859		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Intellectual Disability	Mental retardation	BEFREE	29656859, 30466987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	29656859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	39707840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	30342492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Jarcho-Levin syndrome	Jarcho-Levin Syndrome	BEFREE	10986040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	35618095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30673513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	21079657, 23893409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	22294416		★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	22294416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	30518396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	30518396	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18287027, 26690702, 26739507, 27815263, 8875995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	26739507, 27815263, 28923920, 29859176, 30568170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	22294416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22493546, 23211525, 30637779, 30832318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	23043388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18215320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35078435	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25755786, 27830754, 28427197, 31929567, 34599596	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26259918, 34931925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	26608372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	30801854, 8875995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	22988987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	28177907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	28177907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	30343032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Macroglossia	Macroglossia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrostomia	Macrostomia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	21060049, 34646884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	20800221		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	29884837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	GWASCAT_DG	29884837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22403610, 23593420, 23771907, 24919398, 26874851, 28114269, 28177907, 28695110, 29455641, 29774072, 29904382, 30622177, 31085100, 31358835, 31364167, 31415244 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	28114269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29395309, 30093563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	16211313, 31014126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29455641, 31174180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25411317, 26515598, 26575700, 27852699, 28342318, 28475014, 28536612, 29348860, 31008116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23142633, 28177907, 29151594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20101234, 30251751, 30665264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16273260, 24953529, 26576539, 28052040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21487037, 21813176, 22988987, 23041612, 23142633, 23285131, 23593420, 23771907, 23922987, 24706440, 24831657, 25068995, 25542006, 26259918, 26690702 View all (22 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16211313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	28114269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	28114269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28650466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	28114269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	22988987, 25937048, 29296874, 29872501, 31534006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	24940037	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	22988987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	23278988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	23278988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19177143, 23593420, 31287590, 33549124, 35260073, 36539575, 36622276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19802008, 23593420, 24104062, 28218743, 28731148, 29313974, 31287590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27542227	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	29313974, 33549124, 37373286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	19693801, 20800221, 29073752		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	19693801, 20800221		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesomelia	Mesomelia	BEFREE	14745966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesomelia	Mesomelia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	29845703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	21494683, 28296937	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	21494683, 28296937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	19802008, 31287590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	32892507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	23518061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multicystic Dysplastic Kidney	Multicystic renal dysplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22781592, 22988987, 31148590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	27370539, 31649263		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	33174051	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	34101510	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	37119187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	28790171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	31085100	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	31085100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28687750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18287027, 19448672, 23041612, 24158497, 25068995, 25212991, 25411317, 25542006, 26259918, 26515598, 26575700, 26608372, 26874851, 27440078, 27852699 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	18604725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	26625251, 31441359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	32705280	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	32392803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	34079083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21487037, 26305508, 28177907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29167529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonsyndromic Deafness	Nonsyndromic Deafness	CLINGEN_DG	27162350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculomotor apraxia	Oculomotor apraxia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculovestibuloauditory syndrome	Oculovestibuloauditory Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral cleft	Oral cleft	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	34061439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteochondrodysplasias	Osteochondrodysplasia	BEFREE	19236432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	22057548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	19561643, 28618961, 29213214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22293903, 28618961, 30742741, 33401251, 36468636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Mucinous Adenocarcinoma	Ovarian adenocarcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26515598, 26575700, 27852699, 28342318, 28475014, 28536612, 29348860, 31008116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25056203, 26515598, 27852699, 28475014, 28536612, 32989221, 37628927, 39341888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26515598	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31878941	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23142633, 28177907, 29151594, 29856777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26259918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25945796, 26191284, 29856777, 34599596, 34763666, 37096681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	21494683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	30889382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	24007783	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary craniopharyngioma	Papillary Craniopharyngioma	BEFREE	28427201, 30060804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29113233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Penis agenesis	Penis Agenesis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	27302879	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	31099269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Port-Wine Stain	Phakomatosis pigmentovascularis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	22869035, 25798337, 31291229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	GWASDB_DG	22869035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Posteriorly rotated ear	Posteriorly Rotated Ear	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	21813176, 29849118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	18604725, 21813176, 23153538, 29849118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	29849118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	18354269, 23153538, 23285131, 30631148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	18354269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20101234, 30251751, 30665264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15305379, 24505114, 32484838, 35131873, 35154101, 37552603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30251751, 32415173	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	31320835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Stenosis	Pulmonary Stenosis	BEFREE	17632781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	16211313, 31014126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19448672, 20185829, 25542006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	34646884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	31636631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	26196693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Robinow Syndrome	Robinow Syndrome	BEFREE	10986040, 12011143, 12548386, 14745966, 17061261, 17665217, 18831060, 19530173, 19640924, 19918918, 21693067, 22178368, 23850867, 24932600, 31617258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Robinow Syndrome	Robinow syndrome	Pubtator	10986040, 21693067, 24932600, 31617258, 33048444, 35344616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Robinow syndrome autosomal recessive	Robinow syndrome	Pubtator	31617258, 35344616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Robinow Syndrome, Autosomal Dominant	Robinow Syndrome	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
ROBINOW SYNDROME, AUTOSOMAL DOMINANT 1	Robinow Syndrome	GENOMICS_ENGLAND_DG	19461659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Robinow syndrome, autosomal recessive	Robinow Syndrome	UNIPROT_DG	10932186, 10932187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Robinow syndrome, autosomal recessive	Robinow Syndrome	CLINVAR_DG	10932186, 19640924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Robinow syndrome, autosomal recessive	Robinow Syndrome	BEFREE	10932187, 14745966, 15952209, 16049033, 17632781, 17665217, 19461659, 22178368, 26284319, 31617258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Robinow syndrome, autosomal recessive	Robinow Syndrome	CTD_human_DG	12815588, 15952209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Robinow syndrome, autosomal recessive	Robinow Syndrome	GENOMICS_ENGLAND_DG	19461659		★★★★★ ★☆☆☆☆ Found in Text Mining only
ROBINOW SYNDROME, AUTOSOMAL RECESSIVE, WITH APLASIA/HYPOPLASIA OF PHALANGES AND METACARPALS/METATARSALS	ROBINOW SYNDROME, WITH APLASIA/HYPOPLASIA OF PHALANGES AND METACARPALS/METATARSALS	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
ROBINOW SYNDROME, AUTOSOMAL RECESSIVE, WITH BRACHY-SYN-POLYDACTYLY	ROBINOW SYNDROME, WITH BRACHY-SYN-POLYDACTYLY	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	22294416, 26173023, 26739507		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	30518396	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	30518396	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Ewing	Sarcoma	Pubtator	26739507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	21494683, 24500708	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASDB_DG	22883433		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia Spectrum and Other Psychotic Disorders	Schizophrenia	Pubtator	30178121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	22538398		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seasonal Affective Disorder	Seasonal Affective Disorder	PSYGENET_DG	22538398		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizures	Seizures	Pubtator	39707840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skeletal dysplasia	Skeletal Dysplasia	BEFREE	19236432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Abnormalities	Skin abnormalities	Pubtator	34995387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	23922987, 34995387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	23440187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	34088900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylocostal dysostosis autosomal recessive	Spondylocostal dysostosis	Pubtator	10986040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30293994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28559016, 29790687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	28521453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	23211525, 29167529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16273260, 21487037, 24953529, 26576539, 28052040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	28052040	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	16367923, 19375421, 26708384, 28052040, 34319035, 34472665	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	24158497, 34162762, 34931925	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	24741632	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Strabismus	Strabismus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Syndactyly	Syndactyly	BEFREE	19461659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Syndactyly	Syndactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Syndactyly of fingers	Syndactyly of fingers	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Syndactyly of the toes	Syndactyly Of The Toes	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of fallot	Pubtator	37749917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thoracic hemivertebra	Thoracic hemivertebra	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thoracolumbar scoliosis	Thoracolumbar scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26874851, 29693179, 31150511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27852699, 31150511, 32303620, 40427627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	22490406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	31929567	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	28427201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25755786, 32271410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	31235702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	28545453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	24940037	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	10986040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

RORA (RAR related orphan receptor A)