MIIP (migration and invasion inhibitory protein)

Gene

• Entrez ID: 60672
• Gene name: Migration and invasion inhibitory protein
• Gene symbol: MIIP
• Synonyms (NCBI Gene): IIP45
• Chromosome: 1
• Chromosome location: 1p36.22
• Summary: This gene encodes a protein that interacts with the oncogene protein insulin-like growth factor binding protein 2 and may function as an inhibitor of cell migration and invasion. This protein also interacts with the cell division protein 20 and may be inv

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1149151	hsa-miR-1915	CLIP-seq
MIRT1149152	hsa-miR-3183	CLIP-seq
MIRT1149153	hsa-miR-4469	CLIP-seq
MIRT1149154	hsa-miR-4723-3p	CLIP-seq
MIRT1149155	hsa-miR-642a	CLIP-seq
MIRT2272058	hsa-miR-3620	CLIP-seq
MIRT2272059	hsa-miR-3692	CLIP-seq
MIRT2571082	hsa-miR-1299	CLIP-seq
MIRT1149151	hsa-miR-1915	CLIP-seq
MIRT1149152	hsa-miR-3183	CLIP-seq
MIRT2571083	hsa-miR-326	CLIP-seq
MIRT2571084	hsa-miR-330-5p	CLIP-seq
MIRT2272058	hsa-miR-3620	CLIP-seq
MIRT2272059	hsa-miR-3692	CLIP-seq
MIRT1149153	hsa-miR-4469	CLIP-seq
MIRT1149154	hsa-miR-4723-3p	CLIP-seq
MIRT1149155	hsa-miR-642a	CLIP-seq
MIRT2571085	hsa-miR-875-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183, 32814053, 33961781
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	IEA
GO:0030336	Process	Negative regulation of cell migration	IEA

Other IDs

• MIM: 608772
• HGNC: 25715
• e!Ensembl: ENSG00000116691

Protein

• UniProt ID: Q5JXC2
• Protein name: Migration and invasion-inhibitory protein (IGFBP2-binding protein) (Invasion-inhibitory protein 45) (IIp45)
• Protein function: Inhibits glioma cells invasion and down-regulates adhesion- and motility-associated genes such as NFKB2 and ICAM1. Exhibits opposing effects to IGFBP2 on cell invasion.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15734	MIIP	39 → 377	Migration and invasion-inhibitory	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Isoform 1 is expressed in brain but underexpressed in glioma tissues, at protein level. Isoform 2 is not detected in normal organs, but is expressed in gliomas with increasing levels with glioma progression. On the contrary
• Sequence:

  MVEAEELAQLRLLNLELLRQLWVGQDAVRRSVARAASESSLESSSSYNSETPSTPETSST
  SLSTSCPRGRSSVWGPPDACRGDLRDVARSGVASLPPAKCQHQESLGRPRPHSAPSLGTS
  SLRDPEPSGRLGDPGPQEAQTPRSILAQQSKLSKPRVTFSEESAVPKRSWRLRPYLGYDW
  IAGSLDTSSSITSQPEAFFSKLQEFRETNKEECICSHPEPQLPGLRESSGSGVEEDHECV
  YCYRVNRRLFPVPVDPGTPCRLCRTPRDQQGPGTLAQPAHVRVSIPLSILEPPHRYHIHR
  RKSFDASDTLALPRHCLLGWDIFPPKSEKSSAPRNLDLWSSVSAEAQHQKLSGTSSPFHP
  ASPMQMLPPTPTWSVPQVPRPHVPRQKP

• Sequence length: 388

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26824318		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20103646, 25873164, 31078343		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32196585	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27741356, 29038521		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	27760566	Inhibit	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26825982	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	20418911		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	14617774, 20418911		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	15867349		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20008322	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20418911, 27741356		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26825982	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26824318	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27760566	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20103646, 25873164, 31078343		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29343850		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31092266, 31639006		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30588008		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20103646, 31092266		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29805670		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15867349, 25873164, 27741356, 29343850, 30588008, 31092266		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26824318		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29343850		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31092266, 31639006		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30588008		★☆☆☆☆ Found in Text Mining only