Gene Gene information from NCBI Gene database.
Entrez ID 605
Gene name BAF chromatin remodeling complex subunit BCL7A
Gene symbol BCL7A
Synonyms (NCBI Gene)
BCL7SMARCJ1
Chromosome 12
Chromosome location 12q24.31
Summary This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-terminal region of the gene product is disrupted, which is thought to be related to the patho
miRNA miRNA information provided by mirtarbase database.
754
miRTarBase ID miRNA Experiments Reference
MIRT002399 hsa-let-7b-5p MicroarrayqRT-PCR 18026111
MIRT006552 hsa-miR-29a-3p Luciferase reporter assay 20566844
MIRT017268 hsa-miR-335-5p Microarray 18185580
MIRT050374 hsa-miR-24-3p CLASH 23622248
MIRT053446 hsa-miR-203a-3p Microarray 23807165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin NAS 12192000, 29374058
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005654 Component Nucleoplasm TAS
GO:0006338 Process Chromatin remodeling NAS 10078207, 29374058
GO:0006357 Process Regulation of transcription by RNA polymerase II NAS 18809673, 29374058
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601406 1004 ENSG00000110987
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q4VC05
Protein name B-cell CLL/lymphoma 7 protein family member A
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04714 BCL_N 3 51 BCL7, N-terminal conserver region Family
Sequence
MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKN
KNKKKGKDEKCGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN
SAVPSDGTEAKVDEAQADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAA
ETSAISQDLEGVPPSKKMKLEASQQNSEEM
Sequence length 210
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  ATP-dependent chromatin remodeling  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BCL7A-related disorder Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GOUT GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adult Diffuse Large B-Cell Lymphoma B-cell Lymphoma BEFREE 19336552
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 37322917 Associate
★☆☆☆☆
Found in Text Mining only
Astrocytoma Astrocytoma Pubtator 18670637 Associate
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 10496350
★☆☆☆☆
Found in Text Mining only
Burkitt Lymphoma Burkitt lymphoma Pubtator 28465297, 8605326 Associate
★☆☆☆☆
Found in Text Mining only
Burkitt Lymphoma Burkitt`s Lymphoma BEFREE 31558468
★☆☆☆☆
Found in Text Mining only
Carcinoma, Ovarian Epithelial Ovarian Epithelial carcinoma BEFREE 31077237
★☆☆☆☆
Found in Text Mining only
Cognition Disorders Cognition disorder Pubtator 37322917 Associate
★☆☆☆☆
Found in Text Mining only
Cognitive Dysfunction Cognition disorder Pubtator 37322917 Associate
★☆☆☆☆
Found in Text Mining only
Congenital chromosomal disease Congenital Chromosomal Disease BEFREE 8605326
★☆☆☆☆
Found in Text Mining only