Gene Gene information from NCBI Gene database.
Entrez ID 60495
Gene name Heparanase 2 (inactive)
Gene symbol HPSE2
Synonyms (NCBI Gene)
HPA2HPR2UFSUFS1
Chromosome 10
Chromosome location 10q24.2
Summary This gene encodes a heparanase enzyme. The encoded protein is a endoglycosidase that degrades heparin sulfate proteoglycans located on the extracellular matrix and cell surface. This protein may be involved in biological processes involving remodeling of
SNPs SNP information provided by dbSNP.
7
SNP ID Visualize variation Clinical significance Consequence
rs267606864 G>A,C Pathogenic Missense variant, coding sequence variant, genic downstream transcript variant, stop gained, non coding transcript variant
rs267606865 G>A Pathogenic Coding sequence variant, stop gained, non coding transcript variant, 5 prime UTR variant, intron variant
rs267606866 G>A Pathogenic Coding sequence variant, genic downstream transcript variant, stop gained, non coding transcript variant, intron variant
rs397515338 TT>- Pathogenic Coding sequence variant, non coding transcript variant, genic downstream transcript variant, frameshift variant
rs397515452 T>A Pathogenic Missense variant, coding sequence variant, genic downstream transcript variant, non coding transcript variant, 3 prime UTR variant
miRNA miRNA information provided by mirtarbase database.
87
miRTarBase ID miRNA Experiments Reference
MIRT1054377 hsa-miR-1266 CLIP-seq
MIRT1054378 hsa-miR-15a CLIP-seq
MIRT1054379 hsa-miR-15b CLIP-seq
MIRT1054380 hsa-miR-16 CLIP-seq
MIRT1054381 hsa-miR-195 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
BTF3 Activation 17312387
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0005886 Component Plasma membrane TAS
GO:0008283 Process Cell population proliferation IEA
GO:0008284 Process Positive regulation of cell population proliferation IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
613469 18374 ENSG00000172987
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WWQ2
Protein name Inactive heparanase-2 (Hpa2)
Protein function Binds heparin and heparan sulfate with high affinity, but lacks heparanase activity. Inhibits HPSE, possibly by competing for its substrates (in vitro).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03662 Glyco_hydro_79n 169 408 Glycosyl hydrolase family 79, N-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed, with the highest expression in brain, mammary gland, prostate, small intestine, testis and uterus. In the central nervous system, expressed in the spinal cord, caudate nucleus, thalamus, substantia nigra, medulla oblo
Sequence
MRVLCAFPEAMPSSNSRPPACLAPGALYLALLLHLSLSSQAGDRRPLPVDRAAGLKEKTL
ILLDVSTKNPVRTVNENFLSLQLDPSIIHDGWLDFLSSKRLVTLARGLSPAFLRFGGKRT
DFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGCKIAQHPDVMLELQREK
AAQMHLVLLKEQFSNTYSNLILTARSLDKLYNFADCSGLHLIFALNALRRNPNNSWNSSS
ALSLLKYSASKKYNISWELGNEPNNYRTMHGRAVNGSQLGKDYIQLKSLLQPIRIYSRAS
LYGPNIGRPRKNVIALLDGFMKVAGSTVDAVTWQHCYIDGRVVKVMDFLKTRLLDTLSDQ
IRKIQKVVNTYTPGKKIWLEGVVTTSAGGTNNLSDSYAAGFLWLNTLG
MLANQGIDVVIR
HSFFDHGYNHLVDQNFNPLPDYWLSLLYKRLIGPKVLAVHVAGLQRKPRPGRVIRDKLRI
YAHCTNHHNHNYVRGSITLFIINLHRSRKKIKLAGTLRDKLVHQYLLQPYGQEGLKSKSV
QLNGQPLVMVDDGTLPELKPRPLRAGRTLVIPPVTMGFYVVKNVNALACRYR
Sequence length 592
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Glycosaminoglycan degradation
Metabolic pathways
Proteoglycans in cancer
  HS-GAG degradation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
22
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Congenital anomaly of kidney and urinary tract Pathogenic; Likely pathogenic rs2133986448, rs267606865 RCV001849621
RCV001849249
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
HPSE2-related disorder Pathogenic rs778121647 RCV003415594
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ochoa syndrome Pathogenic rs2133951833, rs184270108 RCV002254040
RCV002254043
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Urofacial syndrome type 1 Pathogenic; Likely pathogenic rs2134250333, rs267606866, rs397515338, rs1469962264, rs267606864, rs267606865, rs778121647, rs2133951833, rs184270108, rs397515452 RCV001783434
RCV000000103
RCV000000104
RCV000000105
RCV000000108
View all (5 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ASTHMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CAKUT Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute Coronary Syndrome Coronary Syndrome BEFREE 11514372
★☆☆☆☆
Found in Text Mining only
Acute leukemia Leukemia BEFREE 19277580
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 1382719
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 3193797
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 40419521 Associate
★☆☆☆☆
Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE Lymphocytic Leukemia BEFREE 8104532
★☆☆☆☆
Found in Text Mining only
Bladder Neoplasm Bladder Neoplasm BEFREE 31732739
★☆☆☆☆
Found in Text Mining only
Bloom Syndrome Bloom Syndrome BEFREE 19082798
★☆☆☆☆
Found in Text Mining only
Bone Diseases Bone disease Pubtator 36980254 Inhibit
★☆☆☆☆
Found in Text Mining only
Bone Diseases Bone disease Pubtator 36980254 Associate
★☆☆☆☆
Found in Text Mining only