TRMT11 (tRNA methyltransferase 11)

Gene

• Entrez ID: 60487
• Gene name: TRNA methyltransferase 11
• Gene symbol: TRMT11
• Synonyms (NCBI Gene): C6orf75, MDS024, TRM11, TRMT11-1
• Chromosome: 6
• Chromosome location: 6q22.32

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029017	hsa-miR-26b-5p	Microarray	19088304
MIRT2136868	hsa-miR-23a	CLIP-seq
MIRT2136869	hsa-miR-23b	CLIP-seq
MIRT2136870	hsa-miR-23c	CLIP-seq
MIRT2357652	hsa-miR-3674	CLIP-seq
MIRT2357653	hsa-miR-410	CLIP-seq
MIRT2357654	hsa-miR-4699-3p	CLIP-seq
MIRT2651326	hsa-miR-153	CLIP-seq
MIRT2651327	hsa-miR-302f	CLIP-seq
MIRT2651328	hsa-miR-3065-5p	CLIP-seq
MIRT2651329	hsa-miR-338-3p	CLIP-seq
MIRT2651330	hsa-miR-3646	CLIP-seq
MIRT2651331	hsa-miR-369-3p	CLIP-seq
MIRT2651332	hsa-miR-374a	CLIP-seq
MIRT2651333	hsa-miR-374b	CLIP-seq
MIRT2651334	hsa-miR-4307	CLIP-seq
MIRT2651335	hsa-miR-448	CLIP-seq
MIRT2651336	hsa-miR-4530	CLIP-seq
MIRT2651337	hsa-miR-505	CLIP-seq
MIRT2651338	hsa-miR-548aa	CLIP-seq
MIRT2651339	hsa-miR-548ac	CLIP-seq
MIRT2651340	hsa-miR-548d-3p	CLIP-seq
MIRT2651341	hsa-miR-548n	CLIP-seq
MIRT2651342	hsa-miR-548t	CLIP-seq
MIRT2651343	hsa-miR-548z	CLIP-seq
MIRT2651344	hsa-miR-549	CLIP-seq
MIRT2651345	hsa-miR-606	CLIP-seq
MIRT2651346	hsa-miR-922	CLIP-seq
MIRT2651326	hsa-miR-153	CLIP-seq
MIRT2651327	hsa-miR-302f	CLIP-seq
MIRT2651329	hsa-miR-338-3p	CLIP-seq
MIRT2651330	hsa-miR-3646	CLIP-seq
MIRT2651331	hsa-miR-369-3p	CLIP-seq
MIRT2651332	hsa-miR-374a	CLIP-seq
MIRT2651333	hsa-miR-374b	CLIP-seq
MIRT2651335	hsa-miR-448	CLIP-seq
MIRT2651336	hsa-miR-4530	CLIP-seq
MIRT2651338	hsa-miR-548aa	CLIP-seq
MIRT2651339	hsa-miR-548ac	CLIP-seq
MIRT2651340	hsa-miR-548d-3p	CLIP-seq
MIRT2651343	hsa-miR-548z	CLIP-seq
MIRT2651344	hsa-miR-549	CLIP-seq
MIRT2651345	hsa-miR-606	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000049	Function	TRNA binding	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 33961781, 34948388
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	34948388
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0006396	Process	RNA processing	IEA
GO:0008033	Process	TRNA processing	IEA
GO:0008168	Function	Methyltransferase activity	IBA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032259	Process	Methylation	IEA
GO:0043528	Component	TRNA (m2G10) methyltransferase complex	IDA	37283053
GO:0160102	Function	TRNA (guanine(10)-N2)-methyltransferase activity	IDA	37283053
GO:0160102	Function	TRNA (guanine(10)-N2)-methyltransferase activity	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q7Z4G4
• Protein name: tRNA (guanine(10)-N(2))-methyltransferase TRMT11 (EC 2.1.1.214) (tRNA methyltransferase 11 homolog)
• Protein function: Catalytic subunit of the TRMT11-TRM112 methyltransferase complex, that specifically mediates the S-adenosyl-L-methionine-dependent N(2)-methylation of guanosine nucleotide at position 10 (m2G10) in tRNAs (PubMed:37283053). This is one of the maj
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01170	UPF0020	189 → 326	Putative RNA methylase family UPF0020	Domain

• Sequence:

  MALSCTLNRYLLLMAQEHLEFRLPEIKSLLLLFGGQFASSQETYGKSPFWILSIPSEDIA
  RNLMKRTVCAKSIFELWGHGQSPEELYSSLKNYPVEKMVPFLHSDSTYKIKIHTFNKTLT
  QEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDPNCIPENPHNIYFGRWIADGQR
  ELIESYSVKKRHFIGNTSMDAGLSFIMANHGKVKENDIVFDPFVGTGGLLIACAHFGAYV
  YGTDIDYNTVHGLGKATRKNQKWRGPDENIRANLRQYGLEKYYLDVLVSDASKPSWRKGT
  YFDAIITDPPYGIRESTRRTGSQKEIPKGIEKWEKCPESHVPVSLSYHLSDMFLDLLNFA
  AETLVLGGRLVYWLPVYTPEYTEEMVPWHPCLELVSNCEQKLSSHTSRRLITMEKVKKFE
  NRDQYSHLLSDHFLPYQGHNSFREKYFSGVTKRIAKEEKSTQE

• Sequence length: 463

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEPROSY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHATIC METASTASIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alopecia	Alopecia	GWASCAT_DG	28196072		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	30705370		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30705370	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30705370	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	30705370		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30705370	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	36220400	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	30705370		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Giant Cell Glioblastoma	Giant Cell Glioblastoma	CTD_human_DG	30705370		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	CTD_human_DG	30705370		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	30705370	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma Multiforme	Glioblastoma	CTD_human_DG	30705370		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	30705370		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic Metastasis	CTD_human_DG	30705370		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	30705370		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	30705370		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	30705370		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	30705370		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	30705370		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	30705370		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	30705370		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	30705370		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	30705370		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	30705370		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30705370	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22386179, 25238935, 34417538	Associate	★☆☆☆☆ Found in Text Mining only