Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6045
Gene name	Ring finger protein 2
Gene symbol	RNF2
Synonyms (NCBI Gene)	BAP-1BAP1DINGHIPI3LUSYAMRING1BRING2
Chromosome	1
Chromosome location	1q25.3
Summary	Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been

358

Show/Hide all (358)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006163	hsa-miR-200b-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006163	hsa-miR-200b-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006163	hsa-miR-200b-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006164	hsa-miR-200c-3p	LacZ reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006164	hsa-miR-200c-3p	LacZ reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006164	hsa-miR-200c-3p	LacZ reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006166	hsa-miR-181a-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006166	hsa-miR-181a-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006166	hsa-miR-181a-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006167	hsa-miR-181b-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006167	hsa-miR-181b-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006167	hsa-miR-181b-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006163	hsa-miR-200b-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006163	hsa-miR-200b-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006163	hsa-miR-200b-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006164	hsa-miR-200c-3p	LacZ reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006164	hsa-miR-200c-3p	LacZ reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006164	hsa-miR-200c-3p	LacZ reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006166	hsa-miR-181a-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006166	hsa-miR-181a-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006166	hsa-miR-181a-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006167	hsa-miR-181b-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006167	hsa-miR-181b-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006167	hsa-miR-181b-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006163	hsa-miR-200b-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006163	hsa-miR-200b-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006163	hsa-miR-200b-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006164	hsa-miR-200c-3p	LacZ reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006164	hsa-miR-200c-3p	LacZ reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006164	hsa-miR-200c-3p	LacZ reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006166	hsa-miR-181a-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006166	hsa-miR-181a-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006166	hsa-miR-181a-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006167	hsa-miR-181b-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006167	hsa-miR-181b-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT006167	hsa-miR-181b-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	21840484
MIRT021040	hsa-miR-155-5p	Proteomics	18668040
MIRT021180	hsa-miR-186-5p	Sequencing	20371350
MIRT030193	hsa-miR-26b-5p	Microarray	19088304
MIRT030624	hsa-miR-24-3p	Sequencing	20371350
MIRT049365	hsa-miR-92a-3p	CLASH	23622248
MIRT619341	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT619340	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT619339	hsa-miR-10a-5p	HITS-CLIP	23824327
MIRT619338	hsa-miR-10b-5p	HITS-CLIP	23824327
MIRT639419	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT619337	hsa-miR-3607-3p	HITS-CLIP	23824327
MIRT625968	hsa-miR-548ac	HITS-CLIP	23824327
MIRT625967	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT625966	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT625965	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT625964	hsa-miR-548z	HITS-CLIP	23824327
MIRT625963	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT625962	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT625961	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT625960	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT625959	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT625958	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT625957	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT619341	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT619340	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT619339	hsa-miR-10a-5p	HITS-CLIP	23824327
MIRT619338	hsa-miR-10b-5p	HITS-CLIP	23824327
MIRT639419	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT619337	hsa-miR-3607-3p	HITS-CLIP	23824327
MIRT625968	hsa-miR-548ac	HITS-CLIP	23824327
MIRT625967	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT625966	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT625965	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT625964	hsa-miR-548z	HITS-CLIP	23824327
MIRT625963	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT625962	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT625961	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT625960	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT625959	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT625958	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT625957	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT619341	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT619340	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT619339	hsa-miR-10a-5p	HITS-CLIP	23824327
MIRT619338	hsa-miR-10b-5p	HITS-CLIP	23824327
MIRT639419	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT619337	hsa-miR-3607-3p	HITS-CLIP	23824327
MIRT639418	hsa-miR-520d-5p	HITS-CLIP	23824327
MIRT639417	hsa-miR-524-5p	HITS-CLIP	23824327
MIRT625968	hsa-miR-548ac	HITS-CLIP	23824327
MIRT625967	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT625966	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT625965	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT625964	hsa-miR-548z	HITS-CLIP	23824327
MIRT625963	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT625962	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT625961	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT625960	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT625959	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT625958	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT625957	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT619341	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT619340	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT619339	hsa-miR-10a-5p	HITS-CLIP	23824327
MIRT619338	hsa-miR-10b-5p	HITS-CLIP	23824327
MIRT619337	hsa-miR-3607-3p	HITS-CLIP	23824327
MIRT619341	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT619340	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT619339	hsa-miR-10a-5p	HITS-CLIP	23824327
MIRT619338	hsa-miR-10b-5p	HITS-CLIP	23824327
MIRT619337	hsa-miR-3607-3p	HITS-CLIP	23824327
MIRT030624	hsa-miR-24-3p	PAR-CLIP	21572407
MIRT268871	hsa-miR-149-5p	PAR-CLIP	21572407
MIRT554692	hsa-miR-7844-5p	PAR-CLIP	21572407
MIRT554691	hsa-miR-4794	PAR-CLIP	21572407
MIRT554690	hsa-miR-664a-5p	PAR-CLIP	21572407
MIRT554689	hsa-miR-3064-5p	PAR-CLIP	21572407
MIRT554687	hsa-miR-6504-5p	PAR-CLIP	21572407
MIRT554688	hsa-miR-4284	PAR-CLIP	21572407
MIRT619341	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT619340	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT619339	hsa-miR-10a-5p	HITS-CLIP	23824327
MIRT619338	hsa-miR-10b-5p	HITS-CLIP	23824327
MIRT639419	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT619337	hsa-miR-3607-3p	HITS-CLIP	23824327
MIRT625968	hsa-miR-548ac	HITS-CLIP	23824327
MIRT625967	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT625966	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT625965	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT625964	hsa-miR-548z	HITS-CLIP	23824327
MIRT625963	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT625962	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT625961	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT625960	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT625959	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT625958	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT625957	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT619341	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT619340	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT619339	hsa-miR-10a-5p	HITS-CLIP	23824327
MIRT619338	hsa-miR-10b-5p	HITS-CLIP	23824327
MIRT639419	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT619337	hsa-miR-3607-3p	HITS-CLIP	23824327
MIRT625968	hsa-miR-548ac	HITS-CLIP	23824327
MIRT625967	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT625966	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT625965	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT625964	hsa-miR-548z	HITS-CLIP	23824327
MIRT625963	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT625962	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT625961	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT625960	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT625959	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT625958	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT625957	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT619341	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT619340	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT619339	hsa-miR-10a-5p	HITS-CLIP	23824327
MIRT619338	hsa-miR-10b-5p	HITS-CLIP	23824327
MIRT639419	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT619337	hsa-miR-3607-3p	HITS-CLIP	23824327
MIRT639418	hsa-miR-520d-5p	HITS-CLIP	23824327
MIRT639417	hsa-miR-524-5p	HITS-CLIP	23824327
MIRT625968	hsa-miR-548ac	HITS-CLIP	23824327
MIRT625967	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT625966	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT625965	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT625964	hsa-miR-548z	HITS-CLIP	23824327
MIRT625963	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT625962	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT625961	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT625960	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT625959	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT625958	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT625957	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT619341	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT619340	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT619339	hsa-miR-10a-5p	HITS-CLIP	23824327
MIRT619338	hsa-miR-10b-5p	HITS-CLIP	23824327
MIRT619337	hsa-miR-3607-3p	HITS-CLIP	23824327
MIRT619341	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT619340	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT619339	hsa-miR-10a-5p	HITS-CLIP	23824327
MIRT619338	hsa-miR-10b-5p	HITS-CLIP	23824327
MIRT619337	hsa-miR-3607-3p	HITS-CLIP	23824327
MIRT030624	hsa-miR-24-3p	PAR-CLIP	21572407
MIRT268871	hsa-miR-149-5p	PAR-CLIP	21572407
MIRT554692	hsa-miR-7844-5p	PAR-CLIP	21572407
MIRT554691	hsa-miR-4794	PAR-CLIP	21572407
MIRT554690	hsa-miR-664a-5p	PAR-CLIP	21572407
MIRT554689	hsa-miR-3064-5p	PAR-CLIP	21572407
MIRT554687	hsa-miR-6504-5p	PAR-CLIP	21572407
MIRT554688	hsa-miR-4284	PAR-CLIP	21572407
MIRT1312409	hsa-miR-149	CLIP-seq
MIRT1312410	hsa-miR-1915	CLIP-seq
MIRT1312411	hsa-miR-200b	CLIP-seq
MIRT1312412	hsa-miR-200c	CLIP-seq
MIRT1312413	hsa-miR-2114	CLIP-seq
MIRT1312414	hsa-miR-214	CLIP-seq
MIRT1312415	hsa-miR-24	CLIP-seq
MIRT1312416	hsa-miR-302f	CLIP-seq
MIRT1312417	hsa-miR-3143	CLIP-seq
MIRT1312418	hsa-miR-3162-5p	CLIP-seq
MIRT1312419	hsa-miR-3618	CLIP-seq
MIRT1312420	hsa-miR-3619-5p	CLIP-seq
MIRT1312421	hsa-miR-3647-3p	CLIP-seq
MIRT1312422	hsa-miR-3686	CLIP-seq
MIRT1312423	hsa-miR-3689d	CLIP-seq
MIRT1312424	hsa-miR-3922-5p	CLIP-seq
MIRT1312425	hsa-miR-4276	CLIP-seq
MIRT1312426	hsa-miR-429	CLIP-seq
MIRT1312427	hsa-miR-4291	CLIP-seq
MIRT1312428	hsa-miR-4328	CLIP-seq
MIRT1312429	hsa-miR-4427	CLIP-seq
MIRT1312430	hsa-miR-4659a-3p	CLIP-seq
MIRT1312431	hsa-miR-4659b-3p	CLIP-seq
MIRT1312432	hsa-miR-4719	CLIP-seq
MIRT1312433	hsa-miR-4724-5p	CLIP-seq
MIRT1312434	hsa-miR-4726-3p	CLIP-seq
MIRT1312435	hsa-miR-4742-3p	CLIP-seq
MIRT1312436	hsa-miR-4775	CLIP-seq
MIRT1312437	hsa-miR-4778-5p	CLIP-seq
MIRT1312438	hsa-miR-543	CLIP-seq
MIRT1312439	hsa-miR-548aa	CLIP-seq
MIRT1312440	hsa-miR-570	CLIP-seq
MIRT1312441	hsa-miR-590-3p	CLIP-seq
MIRT1312442	hsa-miR-643	CLIP-seq
MIRT1312443	hsa-miR-761	CLIP-seq
MIRT1312444	hsa-miR-922	CLIP-seq
MIRT1312411	hsa-miR-200b	CLIP-seq
MIRT1312412	hsa-miR-200c	CLIP-seq
MIRT1312413	hsa-miR-2114	CLIP-seq
MIRT1312416	hsa-miR-302f	CLIP-seq
MIRT1312426	hsa-miR-429	CLIP-seq
MIRT1312429	hsa-miR-4427	CLIP-seq
MIRT1312433	hsa-miR-4724-5p	CLIP-seq
MIRT2092862	hsa-miR-139-5p	CLIP-seq
MIRT1312411	hsa-miR-200b	CLIP-seq
MIRT1312412	hsa-miR-200c	CLIP-seq
MIRT1312413	hsa-miR-2114	CLIP-seq
MIRT1312416	hsa-miR-302f	CLIP-seq
MIRT1312417	hsa-miR-3143	CLIP-seq
MIRT2092863	hsa-miR-3148	CLIP-seq
MIRT2092864	hsa-miR-3170	CLIP-seq
MIRT2092865	hsa-miR-342-5p	CLIP-seq
MIRT2092866	hsa-miR-3688-3p	CLIP-seq
MIRT1312424	hsa-miR-3922-5p	CLIP-seq
MIRT2092867	hsa-miR-4260	CLIP-seq
MIRT1312426	hsa-miR-429	CLIP-seq
MIRT1312429	hsa-miR-4427	CLIP-seq
MIRT2092868	hsa-miR-4651	CLIP-seq
MIRT2092869	hsa-miR-4652-3p	CLIP-seq
MIRT2092870	hsa-miR-4664-5p	CLIP-seq
MIRT1312433	hsa-miR-4724-5p	CLIP-seq
MIRT2092871	hsa-miR-4797-5p	CLIP-seq
MIRT2092872	hsa-miR-511	CLIP-seq
MIRT1312438	hsa-miR-543	CLIP-seq
MIRT2092873	hsa-miR-586	CLIP-seq
MIRT2092874	hsa-miR-608	CLIP-seq
MIRT2317480	hsa-miR-1284	CLIP-seq
MIRT1312409	hsa-miR-149	CLIP-seq
MIRT1312410	hsa-miR-1915	CLIP-seq
MIRT1312411	hsa-miR-200b	CLIP-seq
MIRT1312412	hsa-miR-200c	CLIP-seq
MIRT1312413	hsa-miR-2114	CLIP-seq
MIRT2317481	hsa-miR-2277-3p	CLIP-seq
MIRT1312415	hsa-miR-24	CLIP-seq
MIRT2317482	hsa-miR-300	CLIP-seq
MIRT1312416	hsa-miR-302f	CLIP-seq
MIRT1312421	hsa-miR-3647-3p	CLIP-seq
MIRT2317483	hsa-miR-381	CLIP-seq
MIRT1312424	hsa-miR-3922-5p	CLIP-seq
MIRT2317484	hsa-miR-3941	CLIP-seq
MIRT2317485	hsa-miR-3945	CLIP-seq
MIRT2317486	hsa-miR-4253	CLIP-seq
MIRT1312425	hsa-miR-4276	CLIP-seq
MIRT1312426	hsa-miR-429	CLIP-seq
MIRT1312429	hsa-miR-4427	CLIP-seq
MIRT2317487	hsa-miR-466	CLIP-seq
MIRT2317488	hsa-miR-4666-3p	CLIP-seq
MIRT2317489	hsa-miR-4672	CLIP-seq
MIRT1312432	hsa-miR-4719	CLIP-seq
MIRT1312433	hsa-miR-4724-5p	CLIP-seq
MIRT1312434	hsa-miR-4726-3p	CLIP-seq
MIRT2317490	hsa-miR-4731-3p	CLIP-seq
MIRT2317491	hsa-miR-4801	CLIP-seq
MIRT1312439	hsa-miR-548aa	CLIP-seq
MIRT2092873	hsa-miR-586	CLIP-seq
MIRT2613311	hsa-miR-1243	CLIP-seq
MIRT2613312	hsa-miR-1283	CLIP-seq
MIRT2613313	hsa-miR-155	CLIP-seq
MIRT2613314	hsa-miR-181a	CLIP-seq
MIRT2613315	hsa-miR-181b	CLIP-seq
MIRT2613316	hsa-miR-181c	CLIP-seq
MIRT2613317	hsa-miR-181d	CLIP-seq
MIRT2613318	hsa-miR-21	CLIP-seq
MIRT2613319	hsa-miR-299-3p	CLIP-seq
MIRT2613320	hsa-miR-3065-5p	CLIP-seq
MIRT1312418	hsa-miR-3162-5p	CLIP-seq
MIRT2613321	hsa-miR-34b	CLIP-seq
MIRT1312419	hsa-miR-3618	CLIP-seq
MIRT2613322	hsa-miR-3654	CLIP-seq
MIRT1312423	hsa-miR-3689d	CLIP-seq
MIRT2613323	hsa-miR-4262	CLIP-seq
MIRT2613324	hsa-miR-4275	CLIP-seq
MIRT2613325	hsa-miR-4282	CLIP-seq
MIRT2613326	hsa-miR-4305	CLIP-seq
MIRT2613327	hsa-miR-4474-3p	CLIP-seq
MIRT2613328	hsa-miR-4491	CLIP-seq
MIRT2613329	hsa-miR-4657	CLIP-seq
MIRT2613330	hsa-miR-4684-5p	CLIP-seq
MIRT2613331	hsa-miR-4699-3p	CLIP-seq
MIRT1312432	hsa-miR-4719	CLIP-seq
MIRT2613332	hsa-miR-4720-3p	CLIP-seq
MIRT2613333	hsa-miR-4738-3p	CLIP-seq
MIRT2613334	hsa-miR-4789-3p	CLIP-seq
MIRT2613335	hsa-miR-4804-3p	CLIP-seq
MIRT2613336	hsa-miR-499a-5p	CLIP-seq
MIRT2613337	hsa-miR-513a-3p	CLIP-seq
MIRT2613338	hsa-miR-548ae	CLIP-seq
MIRT2613339	hsa-miR-548aj	CLIP-seq
MIRT2613340	hsa-miR-548am	CLIP-seq
MIRT2613341	hsa-miR-548m	CLIP-seq
MIRT2613342	hsa-miR-548u	CLIP-seq
MIRT2613343	hsa-miR-548x	CLIP-seq
MIRT2613344	hsa-miR-577	CLIP-seq
MIRT2613345	hsa-miR-590-5p	CLIP-seq
MIRT2613346	hsa-miR-606	CLIP-seq
MIRT2613347	hsa-miR-618	CLIP-seq
MIRT2613348	hsa-miR-891b	CLIP-seq
MIRT2613312	hsa-miR-1283	CLIP-seq
MIRT2613313	hsa-miR-155	CLIP-seq
MIRT2613314	hsa-miR-181a	CLIP-seq
MIRT2613315	hsa-miR-181b	CLIP-seq
MIRT2613316	hsa-miR-181c	CLIP-seq
MIRT2613317	hsa-miR-181d	CLIP-seq
MIRT2613318	hsa-miR-21	CLIP-seq
MIRT2613319	hsa-miR-299-3p	CLIP-seq
MIRT1312418	hsa-miR-3162-5p	CLIP-seq
MIRT2613321	hsa-miR-34b	CLIP-seq
MIRT2613323	hsa-miR-4262	CLIP-seq
MIRT2613324	hsa-miR-4275	CLIP-seq
MIRT2613325	hsa-miR-4282	CLIP-seq
MIRT2613327	hsa-miR-4474-3p	CLIP-seq
MIRT2613328	hsa-miR-4491	CLIP-seq
MIRT2613329	hsa-miR-4657	CLIP-seq
MIRT2613330	hsa-miR-4684-5p	CLIP-seq
MIRT1312432	hsa-miR-4719	CLIP-seq
MIRT2613332	hsa-miR-4720-3p	CLIP-seq
MIRT2613333	hsa-miR-4738-3p	CLIP-seq
MIRT2613334	hsa-miR-4789-3p	CLIP-seq
MIRT2613335	hsa-miR-4804-3p	CLIP-seq
MIRT2613337	hsa-miR-513a-3p	CLIP-seq
MIRT2613338	hsa-miR-548ae	CLIP-seq
MIRT2613339	hsa-miR-548aj	CLIP-seq
MIRT2613340	hsa-miR-548am	CLIP-seq
MIRT2613342	hsa-miR-548u	CLIP-seq
MIRT2613343	hsa-miR-548x	CLIP-seq
MIRT2613344	hsa-miR-577	CLIP-seq
MIRT2613345	hsa-miR-590-5p	CLIP-seq
MIRT2613347	hsa-miR-618	CLIP-seq
MIRT1312442	hsa-miR-643	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
E2F1	Unknown	17873902

Show/Hide all (49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000151	Component	Ubiquitin ligase complex	IBA
GO:0000151	Component	Ubiquitin ligase complex	IDA	16714294
GO:0000151	Component	Ubiquitin ligase complex	IEA
GO:0000278	Process	Mitotic cell cycle	IEA
GO:0000791	Component	Euchromatin	IEA
GO:0000792	Component	Heterochromatin	IEA
GO:0001702	Process	Gastrulation with mouth forming second	IEA
GO:0001739	Component	Sex chromatin	IEA
GO:0003682	Function	Chromatin binding	IBA
GO:0003682	Function	Chromatin binding	IDA	25519132
GO:0003682	Function	Chromatin binding	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	16714294
GO:0005515	Function	Protein binding	IPI	10369680, 15386022, 15960975, 16169070, 16710298, 16943429, 17088979, 17332741, 18629613, 18927235, 19549727, 19636380, 20543829, 20601937, 20696397, 21179169, 21282530, 21772249, 22493164, 22902369, 23523425, 24981860, 25519132, 26496610, 26687479, 27505670, 27705803, 28514442, 287
GO:0005634	Component	Nucleus	IDA	18629613, 21282530
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IDA	16943429
GO:0007281	Process	Germ cell development	IEA
GO:0008270	Function	Zinc ion binding	IDA	16714294
GO:0008270	Function	Zinc ion binding	IEA
GO:0009948	Process	Anterior/posterior axis specification	IEA
GO:0010467	Process	Gene expression	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0016604	Component	Nuclear body	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031519	Component	PcG protein complex	IBA
GO:0031519	Component	PcG protein complex	IDA	16943429, 21282530
GO:0031519	Component	PcG protein complex	IEA
GO:0035102	Component	PRC1 complex	IDA	12167701, 19636380
GO:0035102	Component	PRC1 complex	IEA
GO:0040029	Process	Epigenetic regulation of gene expression	IMP	33864376
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IMP	18629613
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	ISS
GO:0071339	Component	MLL1 complex	IDA	15960975
GO:0071535	Function	RING-like zinc finger domain binding	IPI	16714294
GO:0140862	Function	Histone H2AK119 ubiquitin ligase activity	IEA
GO:0140862	Function	Histone H2AK119 ubiquitin ligase activity	ISS

MIM	HGNC	e!Ensembl
608985	10061	ENSG00000121481

Q99496

Protein name

E3 ubiquitin-protein ligase RING2 (EC 2.3.2.27) (Huntingtin-interacting protein 2-interacting protein 3) (HIP2-interacting protein 3) (Protein DinG) (RING finger protein 1B) (RING1b) (RING finger protein 2) (RING finger protein BAP-1) (RING-type E3 ubiqui

Protein function

E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-119' of histone H2A (H2AK119Ub), thereby playing a central role in histone code and gene regulation (PubMed:15386022, PubMed:16359901, PubMed:21772249, PubMed:25355358, PubMed:

PDB

2H0D , 3GS2 , 3H8H , 3IXS , 3RPG , 4R8P , 4S3O , 6WI7 , 6WI8 , 7ND1 , 8GRM , 8PP7 , 9DBY , 9DDE , 9DGG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13923	zf-C3HC4_2	50 → 90		Domain
PF16207	RAWUL	246 → 330	RAWUL domain RING finger- and WD40-associated ubiquitin-like	Domain

Sequence

MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKN
TMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEY
EAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCS
NASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKD
DSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASG
QFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK

Sequence length

336

Interactions

View interactions

	KEGG		Reactome
	Polycomb repressive complex		Oxidative Stress Induced Senescence SUMOylation of DNA damage response and repair proteins SUMOylation of transcription cofactors SUMOylation of chromatin organization proteins SUMOylation of RNA binding proteins RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known Regulation of PTEN gene transcription Transcriptional Regulation by E2F6

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Luo-Schoch-Yamamoto syndrome	Pathogenic	rs1651768254	RCV001549289	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RNF2-associated neurodevelopmental condition	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RNF2-related disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (59)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	29371181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30954952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angelman Syndrome	Angelman Syndrome	BEFREE	20351251, 28890050		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24903147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29973208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	28029659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12840230, 25470042, 30139998, 31300294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32548262, 36271315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37037816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26869491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30377796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24903147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29719173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31119760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33346749	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital ocular coloboma (disorder)	Congenital ocular coloboma	BEFREE	23669349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29981911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	29707138, 29981911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioid and spindle cell nevus	Spitz nevus	BEFREE	22648325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26936624, 30673298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26936624, 30673298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	27317769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	16528373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	16528373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	33328315	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	30377796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29371181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27911266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	16528373, 30814291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	16528373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12840230, 25470042, 30139998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26936624, 30673298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30377796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29719173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27693633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28029659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28529595, 31695413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17088979, 23318437, 26869491, 29981911, 30139998, 31300294		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26450788, 29707138, 29981911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16528373, 23319651, 25431952, 26450788, 26936624, 27317769, 27693633, 27911266, 28029659, 28529595, 29981911, 30673298, 30954952, 31516586, 31588174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	20351251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	20491773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29719173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27693633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	24903147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24903147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	16528373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28029659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19290474, 29973208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	27317769, 33097530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30673298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31516586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	29394319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28529595, 31695413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34224728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37093683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26869491	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	26869491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	31588174		★★★★★ ★☆☆☆☆ Found in Text Mining only

RNF2 (ring finger protein 2)