Gene Gene information from NCBI Gene database.
Entrez ID 60401
Gene name Ectodysplasin A2 receptor
Gene symbol EDA2R
Synonyms (NCBI Gene)
EDA-A2REDAA2RTNFRSF27XEDAR
Chromosome X
Chromosome location Xq12
Summary The protein encoded by this gene is a type III transmembrane protein of the TNFR (tumor necrosis factor receptor) superfamily, and contains cysteine-rich repeats and a single transmembrane domain. This protein binds to the EDA-A2 isoform of ectodysplasin,
miRNA miRNA information provided by mirtarbase database.
227
miRTarBase ID miRNA Experiments Reference
MIRT016618 hsa-miR-484 Sequencing 20371350
MIRT544097 hsa-miR-511-3p PAR-CLIP 21572407
MIRT544096 hsa-miR-567 PAR-CLIP 21572407
MIRT558240 hsa-miR-4796-5p PAR-CLIP 21572407
MIRT544095 hsa-miR-223-5p PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity IDA 11039935
GO:0005031 Function Tumor necrosis factor receptor activity IEA
GO:0005031 Function Tumor necrosis factor receptor activity NAS 11039935
GO:0005515 Function Protein binding IPI 11039935, 12270937, 15280356, 27144394, 28514442, 32296183, 33961781
GO:0005886 Component Plasma membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300276 17756 ENSG00000131080
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9HAV5
Protein name Tumor necrosis factor receptor superfamily member 27 (X-linked ectodysplasin-A2 receptor) (EDA-A2 receptor)
Protein function Receptor for EDA isoform A2, but not for EDA isoform A1. Mediates the activation of the NF-kappa-B and JNK pathways. Activation seems to be mediated by binding to TRAF3 and TRAF6.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00020 TNFR_c6 3 41 TNFR/NGFR cysteine-rich region Domain
PF00020 TNFR_c6 44 83 TNFR/NGFR cysteine-rich region Domain
Sequence
MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQS
CITCAVINRVQKVNCTATSNAVC
GDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAF
QLSLVEADTPTVPPQEATLVALVSSLLVVFTLAFLGLFFLYCKQFFNRHCQRGGLLQFEA
DKTAKEESLFPVPPSKETSAESQVSENIFQTQPLNPILEDDCSSTSGFPTQESFTMASCT
SESHSHWVHSPIECTELDLQKFSSSASYTGAETLGGNTVESTGDRLELNVPFEVPSP
Sequence length 297
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
  TNFs bind their physiological receptors
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
4
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CHRIST-SIEMENS-TOURAINE SYNDROME Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HYPOGONADISM GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Hypohidrotic X-linked ectodermal dysplasia Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
X-LINKED HYPOHIDROTIC ECTODERMAL DYSPLASIA Disgenet, Orphanet
Disgenet, Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alopecia Alopecia BEFREE 22309448
★☆☆☆☆
Found in Text Mining only
Alopecia, Male Pattern Alopecia, Male Pattern BEFREE 18385763, 22309448
★☆☆☆☆
Found in Text Mining only
Alopecia, Male Pattern Alopecia, Male Pattern GWASDB_DG 22693459
★☆☆☆☆
Found in Text Mining only
Androgenetic Alopecia Androgenetic Alopecia BEFREE 18385763, 22309448, 24352509, 27060448
★☆☆☆☆
Found in Text Mining only
Anterior hypopituitarism Hypopituitarism HPO_DG
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 20145163
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 20145163 Inhibit
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 39300389 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Renal cell carcinoma Pubtator 37919386 Associate
★☆☆☆☆
Found in Text Mining only
Cardiovascular Diseases Cardiovascular disease Pubtator 37079385 Stimulate
★☆☆☆☆
Found in Text Mining only