BCL6 (BCL6 transcription repressor)

Gene

• Entrez ID: 604
• Gene name: BCL6 transcription repressor
• Gene symbol: BCL6
• Synonyms (NCBI Gene): BCL5, BCL6A, LAZ3, ZBTB27, ZNF51
• Chromosome: 3
• Chromosome location: 3q27.3
• Summary: The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of STAT-dependent IL-4 resp

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000640	hsa-miR-9-5p	Luciferase reporter assay	19956200
MIRT004463	hsa-miR-127-3p	Luciferase reporter assay	17581274
MIRT004463	hsa-miR-127-3p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	16766263
MIRT004463	hsa-miR-127-3p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	16766263
MIRT005929	hsa-miR-339-5p	qRT-PCR	20932331
MIRT006324	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006324	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006324	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006324	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006324	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006324	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006927	hsa-miR-155-5p	Luciferase reporter assay	23041630
MIRT006927	hsa-miR-155-5p	Luciferase reporter assay	23041630
MIRT017492	hsa-miR-335-5p	Microarray	18185580
MIRT022507	hsa-miR-124-3p	Microarray	18668037
MIRT035524	hsa-miR-21-5p	Luciferase reporter assay	23416424
MIRT035524	hsa-miR-21-5p	Luciferase reporter assay	23416424
MIRT054375	hsa-miR-205-5p	Luciferase reporter assay, Western blot	22870299
MIRT054375	hsa-miR-205-5p	Luciferase reporter assay, Western blot	22870299
MIRT005929	hsa-miR-339-5p	Immunohistochemistry, Luciferase reporter assay, Western blot	24917186
MIRT731339	hsa-miR-187-3p	Luciferase reporter assay	26845350
MIRT731339	hsa-miR-187-3p	Luciferase reporter assay	26845350
MIRT731339	hsa-miR-187-3p	Luciferase reporter assay	27073562
MIRT732380	hsa-miR-544a	Luciferase reporter assay, qRT-PCR, Western blot	27186677
MIRT732380	hsa-miR-544a	Luciferase reporter assay, qRT-PCR, Western blot	27186677
MIRT006927	hsa-miR-155-5p	qRT-PCR, Western blot	26986233
MIRT006927	hsa-miR-155-5p	qRT-PCR, Western blot	26986233
MIRT006927	hsa-miR-155-5p	qRT-PCR, Western blot	26986233
MIRT006927	hsa-miR-155-5p	qRT-PCR, Western blot	26986233
MIRT734457	hsa-miR-101-3p	Luciferase reporter assay, Western blotting, RNA-seq, qRT-PCR, In situ hybridization	31903129
MIRT735771	hsa-miR-139-3p	Luciferase reporter assay, qRT-PCR	32277518
MIRT735771	hsa-miR-139-3p	Luciferase reporter assay, qRT-PCR	32277518
MIRT735800	hsa-miR-1247-5p	Western blotting, qRT-PCR	33425899
MIRT736975	hsa-miR-144-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	32206063
MIRT755806	miR?144?3p	Luciferase reporter assay, Western blotting, qRT-PCR	34504602
MIRT006324	hsa-miR-30b-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35100079
MIRT819383	hsa-miR-101	CLIP-seq
MIRT819384	hsa-miR-106a	CLIP-seq
MIRT819385	hsa-miR-106b	CLIP-seq
MIRT819386	hsa-miR-10a	CLIP-seq
MIRT819387	hsa-miR-10b	CLIP-seq
MIRT819388	hsa-miR-1197	CLIP-seq
MIRT819389	hsa-miR-1203	CLIP-seq
MIRT819390	hsa-miR-1224-5p	CLIP-seq
MIRT819391	hsa-miR-1225-5p	CLIP-seq
MIRT819392	hsa-miR-124	CLIP-seq
MIRT819393	hsa-miR-1244	CLIP-seq
MIRT819394	hsa-miR-1255a	CLIP-seq
MIRT819395	hsa-miR-1255b	CLIP-seq
MIRT819396	hsa-miR-129-5p	CLIP-seq
MIRT819397	hsa-miR-144	CLIP-seq
MIRT819398	hsa-miR-17	CLIP-seq
MIRT819399	hsa-miR-20a	CLIP-seq
MIRT819400	hsa-miR-20b	CLIP-seq
MIRT819401	hsa-miR-3121-5p	CLIP-seq
MIRT819402	hsa-miR-3140-3p	CLIP-seq
MIRT819403	hsa-miR-329	CLIP-seq
MIRT819404	hsa-miR-3609	CLIP-seq
MIRT819405	hsa-miR-3613-5p	CLIP-seq
MIRT819406	hsa-miR-362-3p	CLIP-seq
MIRT819407	hsa-miR-362-5p	CLIP-seq
MIRT819408	hsa-miR-3681	CLIP-seq
MIRT819409	hsa-miR-3691-5p	CLIP-seq
MIRT819410	hsa-miR-374c	CLIP-seq
MIRT819411	hsa-miR-3941	CLIP-seq
MIRT819412	hsa-miR-4325	CLIP-seq
MIRT819413	hsa-miR-4421	CLIP-seq
MIRT819414	hsa-miR-4731-3p	CLIP-seq
MIRT819415	hsa-miR-4751	CLIP-seq
MIRT819416	hsa-miR-4796-3p	CLIP-seq
MIRT819417	hsa-miR-4801	CLIP-seq
MIRT819418	hsa-miR-500b	CLIP-seq
MIRT819419	hsa-miR-501-5p	CLIP-seq
MIRT819420	hsa-miR-506	CLIP-seq
MIRT819421	hsa-miR-507	CLIP-seq
MIRT819422	hsa-miR-519d	CLIP-seq
MIRT819423	hsa-miR-548ah	CLIP-seq
MIRT819424	hsa-miR-548an	CLIP-seq
MIRT819425	hsa-miR-557	CLIP-seq
MIRT819426	hsa-miR-582-5p	CLIP-seq
MIRT819427	hsa-miR-603	CLIP-seq
MIRT819428	hsa-miR-628-5p	CLIP-seq
MIRT819429	hsa-miR-655	CLIP-seq
MIRT819430	hsa-miR-93	CLIP-seq
MIRT1942121	hsa-miR-1275	CLIP-seq
MIRT1942122	hsa-miR-153	CLIP-seq
MIRT1942123	hsa-miR-187	CLIP-seq
MIRT1942124	hsa-miR-3158-5p	CLIP-seq
MIRT1942125	hsa-miR-331-3p	CLIP-seq
MIRT1942126	hsa-miR-4288	CLIP-seq
MIRT1942127	hsa-miR-4300	CLIP-seq
MIRT1942128	hsa-miR-4447	CLIP-seq
MIRT1942129	hsa-miR-4464	CLIP-seq
MIRT1942130	hsa-miR-4472	CLIP-seq
MIRT1942131	hsa-miR-448	CLIP-seq
MIRT1942132	hsa-miR-450b-5p	CLIP-seq
MIRT1942133	hsa-miR-4525	CLIP-seq
MIRT1942134	hsa-miR-4665-5p	CLIP-seq
MIRT1942135	hsa-miR-4716-3p	CLIP-seq
MIRT1942136	hsa-miR-4723-5p	CLIP-seq
MIRT1942137	hsa-miR-4728-5p	CLIP-seq
MIRT1942138	hsa-miR-4748	CLIP-seq
MIRT1942139	hsa-miR-4763-5p	CLIP-seq
MIRT1942140	hsa-miR-489	CLIP-seq
MIRT819421	hsa-miR-507	CLIP-seq
MIRT1942141	hsa-miR-514	CLIP-seq
MIRT1942142	hsa-miR-514b-3p	CLIP-seq
MIRT819425	hsa-miR-557	CLIP-seq
MIRT1942143	hsa-miR-558	CLIP-seq
MIRT1942144	hsa-miR-625	CLIP-seq
MIRT1942145	hsa-miR-632	CLIP-seq
MIRT1942146	hsa-miR-920	CLIP-seq
MIRT1942147	hsa-miR-939	CLIP-seq
MIRT819388	hsa-miR-1197	CLIP-seq
MIRT819390	hsa-miR-1224-5p	CLIP-seq
MIRT819392	hsa-miR-124	CLIP-seq
MIRT1942122	hsa-miR-153	CLIP-seq
MIRT2180997	hsa-miR-300	CLIP-seq
MIRT2180998	hsa-miR-3613-3p	CLIP-seq
MIRT819405	hsa-miR-3613-5p	CLIP-seq
MIRT2180999	hsa-miR-381	CLIP-seq
MIRT1942126	hsa-miR-4288	CLIP-seq
MIRT1942131	hsa-miR-448	CLIP-seq
MIRT1942132	hsa-miR-450b-5p	CLIP-seq
MIRT2181000	hsa-miR-4666-3p	CLIP-seq
MIRT819415	hsa-miR-4751	CLIP-seq
MIRT819420	hsa-miR-506	CLIP-seq
MIRT819421	hsa-miR-507	CLIP-seq
MIRT819424	hsa-miR-548an	CLIP-seq
MIRT819425	hsa-miR-557	CLIP-seq
MIRT1942145	hsa-miR-632	CLIP-seq
MIRT819388	hsa-miR-1197	CLIP-seq
MIRT819390	hsa-miR-1224-5p	CLIP-seq
MIRT819392	hsa-miR-124	CLIP-seq
MIRT819405	hsa-miR-3613-5p	CLIP-seq
MIRT819415	hsa-miR-4751	CLIP-seq
MIRT819420	hsa-miR-506	CLIP-seq
MIRT819424	hsa-miR-548an	CLIP-seq
MIRT2484362	hsa-miR-1253	CLIP-seq
MIRT2484363	hsa-miR-183	CLIP-seq
MIRT2484364	hsa-miR-3185	CLIP-seq
MIRT2484365	hsa-miR-34a	CLIP-seq
MIRT2484366	hsa-miR-34c-5p	CLIP-seq
MIRT819411	hsa-miR-3941	CLIP-seq
MIRT2484367	hsa-miR-3942-5p	CLIP-seq
MIRT2484368	hsa-miR-409-3p	CLIP-seq
MIRT2484369	hsa-miR-4307	CLIP-seq
MIRT2484370	hsa-miR-4434	CLIP-seq
MIRT2484371	hsa-miR-449a	CLIP-seq
MIRT2484372	hsa-miR-449b	CLIP-seq
MIRT2484373	hsa-miR-4516	CLIP-seq
MIRT2484374	hsa-miR-4517	CLIP-seq
MIRT2484375	hsa-miR-4643	CLIP-seq
MIRT2484376	hsa-miR-466	CLIP-seq
MIRT2484377	hsa-miR-4672	CLIP-seq
MIRT2484378	hsa-miR-4703-5p	CLIP-seq
MIRT2484379	hsa-miR-4789-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ABL1	Repression	15509806
BCL6	Repression	12407182
CTCF	Repression	20733034
FOSL2	Activation	22493372
FOXO3	Activation	15509806
FOXO4	Activation	11777915
IRF4	Repression	17785200
JUND	Activation	22493372
JUND	Repression	18071306
MEF2B	Unknown	23974956
SPI1	Repression	19564417
STAT3	Activation	20228272;23716595
STAT5	Repression	23716595
STAT5A	Repression	16819511
STAT5B	Repression	16819511
ZEB1	Repression	20175752

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11929873
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15577913, 16704730
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000902	Process	Cell morphogenesis	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0001161	Function	Intronic transcription regulatory region sequence-specific DNA binding	IEA
GO:0001222	Function	Transcription corepressor binding	IPI	10898795
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	16704730
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001817	Process	Regulation of cytokine production	IBA
GO:0001953	Process	Negative regulation of cell-matrix adhesion	IEA
GO:0002317	Process	Plasma cell differentiation	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002467	Process	Germinal center formation	IEA
GO:0002634	Process	Regulation of germinal center formation	NAS	7795255
GO:0002682	Process	Regulation of immune system process	IBA
GO:0002829	Process	Negative regulation of type 2 immune response	IEA
GO:0002903	Process	Negative regulation of B cell apoptotic process	NAS	15577913
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IDA	12097386
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IMP	15577913
GO:0005515	Function	Protein binding	IPI	12590135, 16147992, 16819511, 21390126, 22113614, 25416956, 27107012, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	7795255, 10898795, 11929873
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005657	Component	Replication fork	IDA	10490843
GO:0005730	Component	Nucleolus	IDA
GO:0005794	Component	Golgi apparatus	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006974	Process	DNA damage response	IDA	15577913
GO:0007160	Process	Cell-matrix adhesion	IEA
GO:0007266	Process	Rho protein signal transduction	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008104	Process	Intracellular protein localization	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0021859	Process	Pyramidal neuron differentiation	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030183	Process	B cell differentiation	IEA
GO:0030308	Process	Negative regulation of cell growth	IDA	10490843
GO:0030890	Process	Positive regulation of B cell proliferation	IEA
GO:0031490	Function	Chromatin DNA binding	IEA
GO:0031507	Process	Heterochromatin formation	IEA
GO:0032764	Process	Negative regulation of mast cell cytokine production	IEA
GO:0032943	Process	Mononuclear cell proliferation	IEA
GO:0032945	Process	Negative regulation of mononuclear cell proliferation	IEA
GO:0035024	Process	Negative regulation of Rho protein signal transduction	IEA
GO:0042092	Process	Type 2 immune response	IBA
GO:0042092	Process	Type 2 immune response	IEA
GO:0042100	Process	B cell proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0042129	Process	Regulation of T cell proliferation	IEA
GO:0042382	Component	Paraspeckles	IDA	16704730
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	10490843
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043380	Process	Regulation of memory T cell differentiation	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	15577913
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045064	Process	T-helper 2 cell differentiation	IEA
GO:0045580	Process	Regulation of T cell differentiation	IEA
GO:0045591	Process	Positive regulation of regulatory T cell differentiation	IMP	20935202, 22387553
GO:0045595	Process	Regulation of cell differentiation	IBA
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0045629	Process	Negative regulation of T-helper 2 cell differentiation	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045746	Process	Negative regulation of Notch signaling pathway	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	15577913
GO:0045892	Process	Negative regulation of DNA-templated transcription	NAS	9135990
GO:0046872	Function	Metal ion binding	IEA
GO:0048289	Process	Isotype switching to IgE isotypes	IEA
GO:0048294	Process	Negative regulation of isotype switching to IgE isotypes	IEA
GO:0048821	Process	Erythrocyte development	IEA
GO:0048870	Process	Cell motility	IEA
GO:0050727	Process	Regulation of inflammatory response	IBA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050776	Process	Regulation of immune response	NAS	16455075
GO:0051251	Process	Positive regulation of lymphocyte activation	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	16704730
GO:1900099	Process	Negative regulation of plasma cell differentiation	IEA
GO:1903037	Process	Regulation of leukocyte cell-cell adhesion	IEA
GO:1903464	Process	Negative regulation of mitotic cell cycle DNA replication	NAS	10490843
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA
GO:2000147	Process	Positive regulation of cell motility	IEA
GO:2000773	Process	Negative regulation of cellular senescence	IEA

Other IDs

• MIM: 109565
• HGNC: 1001
• e!Ensembl: ENSG00000113916

Protein

• UniProt ID: P41182
• Protein name: B-cell lymphoma 6 protein (BCL-6) (B-cell lymphoma 5 protein) (BCL-5) (Protein LAZ-3) (Zinc finger and BTB domain-containing protein 27) (Zinc finger protein 51)
• Protein function: Transcriptional repressor mainly required for germinal center (GC) formation and antibody affinity maturation which has different mechanisms of action specific to the lineage and biological functions. Forms complexes with different corepressors
• PDB: 1R28, 1R29, 1R2B, 2EN2, 2EOS, 2LCE, 2YRM, 3BIM, 3E4U, 3LBZ, 4CP3, 4U2M, 5H7G, 5H7H, 5MW2, 5MW6, 5MWD, 5N1X, 5N1Z, 5N20, 5N21, 5X4M, 5X4N, 5X4O, 5X4P, 5X4Q, 5X9O, 5X9P, 6C3L, 6C3N, 6CQ1, 6EW6, 6EW7, 6EW8, 6TBT, 6TCJ, 6TOF, 6TOG, 6TOH, 6TOI, 6TOJ, 6TOK, 6TOL, 6TOM, 6TON, 6TOO, 6XMX, 6XWF, 6XXS, 6XYX, 6XZZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00651	BTB	22 → 129	BTB/POZ domain	Domain
  PF00096	zf-C2H2	546 → 568	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	574 → 596	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	602 → 624	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	630 → 652	Zinc finger, C2H2 type	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in germinal center T- and B-cells and in primary immature dendritic cells. {ECO:0000269|PubMed:10981963, ECO:0000269|PubMed:12402037, ECO:0000269|PubMed:15454082, ECO:0000269|PubMed:16142238, ECO:0000269|PubMed:16455075, ECO:
• Sequence:

  MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSI
  FTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDT
  CRKFIKASEAEMVSAIKPPREEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAF
  APSLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVRMPVANPFPKERALPCDSARPVPG
  EYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKAS
  KEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASG
  SPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEP
  ENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGS
  QSPQHAEMCLHTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQT
  HSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEK
  PYKCETCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHC
  EKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPPELPKAC

• Sequence length: 706

Pathways

KEGG:

FoxO signaling pathway
Transcriptional misregulation in cancer
Chemical carcinogenesis - receptor activation

Reactome:

Interleukin-4 and Interleukin-13 signaling
TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain
FOXO-mediated transcription of cell death genes

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOLLICULAR LYMPHOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL HEMORRHAGE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	10923927		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	15370207, 19965641, 25759025, 25780007, 28030830, 30178847, 31395741		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	11175338, 16996269		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	21911423		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15370207, 19965641, 28030830		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	10414499, 10482997, 10753856, 11023530, 11353050, 11493437, 11743658, 11821949, 11972514, 12389616, 12430874, 12515714, 12766583, 14979479, 15024721, 15655367, 15875184, 15892171, 17175379, 17625604, 17889713, 18406879, 18645192, 18925695, 18925696, 19465899, 19549844, 19797725, 20160358, 20385356, 20660332, 21041953, 21277811, 22213394, 23169640, 23335369, 23400934, 23612032, 23716595, 23974956, 25090026, 25596256, 25640395, 25696841, 25769544, 26214636, 26319027, 26573234, 27268052, 27815824, 30143009, 30446717, 30586419, 30666200, 30719149, 31042473, 31171907, 31229156, 8669486, 9283593, 9401082, 9614912		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	15339680, 15982329, 16733207		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	22493372		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	27803134		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	26472169		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36334414	Associate	★☆☆☆☆ Found in Text Mining only
Amaurosis congenita of Leber, type 1	Leber congenital amaurosis	BEFREE	31693188		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	38191942	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	23637631		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	27546026		★☆☆☆☆ Found in Text Mining only
Angioendotheliomatosis	Angioendotheliomatosis	BEFREE	11706077		★☆☆☆☆ Found in Text Mining only
Angioendotheliomatosis	Angioendotheliomatosis	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	15370207, 21083654, 22586046, 27921272, 29241019, 29662631, 31283630		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	29848367	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	22649468	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	39586747	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	25711734, 26932604		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	18378158	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27488442, 28471657, 28811467, 29848367, 31539517		★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	21593872, 28410239		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	10233393, 10406897, 10469447, 10626250, 10666379, 10698307, 10797525, 10843287, 10936424, 10953971, 11039912, 11290603, 11516111, 11567225, 11579468, 11780315, 11943722, 12124346, 12165517, 12580956, 12775568, 12835729, 12860928, 12881702, 14551142, 15024721, 15098010, 15136235, 15252312, 15370207, 15370257, 15375218, 15377470, 15531890, 15611242, 16133367, 16147992, 16188230, 16249378, 16264183, 16377176, 16507780, 16619046, 16712476, 16819511, 16867873, 16996269, 17468402, 17576390, 17651861, 18245479, 18406879, 19701248, 20023635, 20228272, 20331331, 20348878, 20385356, 20510734, 20660329, 20733034, 20966935, 21041953, 21277811, 21394099, 21808017, 22018272, 22025499, 22113614, 22493372, 22493480, 22830357, 23169640, 23348205, 23476051, 23795761, 23949965, 24009228, 24114011, 24222112, 24294388, 24319234, 24662818, 24678684, 24679006, 24698494, 24778012, 24887457, 24943107, 25125624, 25557390, 25573990, 25656449, 25843416, 26414904, 26426741, 26553360, 26565895, 26566802, 26573234, 26657288, 26714592, 26787899, 26865454, 26983850, 27027803, 27029530, 27436361, 27524795, 27717585, 27764808, 27815824, 27818202, 27821509, 27856253, 27880939, 27881582, 27921272, 28315684, 28324774, 28471657, 28485934, 28544233, 28589362, 28656528, 28728856, 28749548, 28760529, 28844114, 28848064, 28849038, 28875978, 28881619, 28887367, 28901193, 28943467, 28984304, 29072703, 29101361, 29104620, 29206290, 29262721, 29285142, 29293322, 29312557, 29319177, 29397940, 29480878, 29490514, 29510377, 29581544, 29678710, 29696026, 29719019, 29902576, 29968852, 29969259, 29972264, 30082494, 30105896, 30143009, 30235749, 30277098, 30279226, 30333862, 30335946, 30355686, 30414952, 30420967, 30496802, 30566857, 30680935, 30687256, 30805081, 30842630, 30874346, 30983568, 31042473, 31063496, 31127030, 31187528, 31229156, 31401377, 31712669, 31788471, 7742550, 7794763, 7945383, 7961119, 8063612, 8167331, 8504412, 8506375, 8557040, 8618443, 8618933, 9209377, 9283593, 9824205		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	12389616, 12507907, 12515714, 12562237, 12775568, 15191563, 15202519, 16249378, 16489068, 17151114, 17476282, 17625604, 17635238, 17785208, 17889713, 17989715, 18801072		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	10803511, 11059755, 14961033, 17134969, 25060588		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27237631		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	28410239		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	8208268	Associate	★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	30832685	Inhibit	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	18378158	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25038272		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	32383815, 34887247	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12944904, 14654791, 16331266, 17963508, 19816083, 20124477, 23637631, 23708665, 23716595, 24282530, 24662818, 24917186, 26049022, 26096934, 28973975, 29104620, 29854311		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17963508, 23716595, 24282530, 24662818, 25477702, 26957268, 27029530, 28973975, 31227749, 33932086	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	30279226		★☆☆☆☆ Found in Text Mining only
Burkitt Leukemia	Burkitt`s Lymphoma	BEFREE	16772123		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	10627476, 11157493, 12477975, 12907442, 20348878, 26763367, 34788985, 8274740, 9160681, 9359519, 9402172	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	11943722, 15291367, 16006805, 16216037, 16772123, 17875505, 18923440, 20348878, 20605493, 21740296, 22002677, 22204827, 23348205, 24179151, 24222112, 25060588, 25125624, 25696841, 28288039, 31229156, 31558468, 8274740, 9359519		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	20080768	Inhibit	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	22358360	Stimulate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	34887247	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24220798, 31754389, 33393503	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	30051528	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	17594153, 34321419	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27237631		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29434966		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28671040	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22491060, 36357817	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	17542409	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28671040		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	32631246, 39294340	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	34669781	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	30031228		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	34887247	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	28315684		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	15370207, 19965641, 28030830		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	23533570		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	23533570	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10803511, 10828040, 11059755, 14961033, 17134969, 19367498, 22047081, 22968395, 23669349, 24648050, 25060588, 27534555, 31375635, 31631728, 8618432		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CGI_DG			★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	25711734		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29393377		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24220798, 32206063	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	10923927, 11035117		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	10923927	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	16519699, 16772123, 18992913, 19797725, 24222112, 28594133, 28628241, 30719149, 8618443, 8750627, 9402330, 9824205		★☆☆☆☆ Found in Text Mining only
Congenital ocular coloboma (disorder)	Congenital ocular coloboma	BEFREE	23669349		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	35151267	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	36746519	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	27803134	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	16996269		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	40122115	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32705173	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	30031228		★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	BEFREE	25038272		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	10414499, 10482997, 10564588, 10637510, 10702417, 10753856, 10887128, 10923927, 11023530, 11106080, 11123421, 11353050, 11493437, 11567225, 11697627, 11742039, 11743658, 11780315, 11818476, 11821949, 11830458, 11840294, 11850073, 11972514, 12118091, 12118116, 12173331, 12200704, 12378521, 12389616, 12399978, 12406872, 12407182, 12430874, 12469325, 12515714, 12675762, 12766583, 12796378, 12826884, 12835729, 14556665, 14655758, 14979479, 15024721, 15277222, 15339680, 15377470, 15385936, 15504248, 15591113, 15609396, 15655367, 15677569, 15875184, 15892171, 15894265, 15894922, 16075463, 16216037, 16484127, 16519699, 16728698, 16733216, 16772602, 17082608, 17088997, 17149956, 17151114, 17175379, 17175383, 17197022, 17360630, 17542409, 17545502, 17573669, 17625604, 17785200, 17889713, 18189332, 18346918, 18406879, 18445693, 18451163, 18452090, 18460403, 18628087, 18645192, 18752503, 18925695, 18925696, 18927431, 19307668, 19465899, 19525926, 19549844, 19706817, 19797725, 19819170, 19855081, 20016842, 20081364, 20385356, 20385364, 20534395, 20579129, 20660332, 21041953, 21277811, 21740296, 22072491, 22113614, 22213394, 22451912, 22665537, 22994707, 23169640, 23335369, 23348205, 23400934, 23612032, 23716595, 23749188, 23911289, 23974956, 24008861, 24040459, 24218026, 24222112, 24390222, 24843885, 25090026, 25589617, 25596256, 25640395, 25696841, 25769544, 25805589, 25827211, 25907897, 25921526, 26158410, 26214636, 26319027, 26373676, 26414904, 26545844, 26573234, 26586460, 26657288, 26865454, 27166359, 27268052, 27268204, 27301994, 27356265, 27419806, 27494852, 27505670, 27760757, 27815824, 27880939, 27881582, 28278726, 28288039, 28485934, 28525305, 28749548, 28930682, 28952038, 29101361, 29293322, 29567771, 29983382, 30113335, 30143009, 30252929, 30287880, 30306208, 30335946, 30446717, 30496802, 30586419, 30666200, 30719149, 31042473, 31123031, 31171907, 31229156, 31288832, 31518494, 31527075, 31615842, 31728727, 31734190, 31734687, 7472775, 7541611, 7677752, 7795255, 8025268, 8208268, 8235596, 8527378, 8555467, 8557040, 8618933, 8669486, 8677742, 8750627, 9019154, 9209651, 9209652, 9283593, 9359519, 9373196, 9389359, 9401082, 9422982, 9427715, 9573674, 9614912, 9648553, 9720713		★☆☆☆☆ Found in Text Mining only
Diffuse Mixed-Cell Lymphoma	Diffuse Lymphoma	CTD_human_DG	25543051		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	19965641		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	30515165	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	27222232, 30610661, 34698105, 37085097	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	28754906, 30610661		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	12477975	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	25711734		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28671040		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25923331	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	16996269		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	16996269		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	21725042		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	21725042		★☆☆☆☆ Found in Text Mining only
Follicular lymphoma	Follicular lymphoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	24114011		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	24114011	Associate	★☆☆☆☆ Found in Text Mining only
Gastric lymphoma	Gastric lymphoma	BEFREE	11353050, 12766583, 16772602, 9283593, 9401082, 9546062		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	21725042		★☆☆☆☆ Found in Text Mining only
Generalized enlarged lymph nodes	Enlarged Lymph Nodes	BEFREE	25625642		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25038272, 28356518, 30420967		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25038272, 30420967	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25038272, 28356518, 30420967		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25038272	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28356518, 30420967		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30420967	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	32843454	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	23799890, 35039330	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	29319368		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	28368400		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	12507894, 34887247	Associate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	26491701		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	23107779	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	31734687	Associate	★☆☆☆☆ Found in Text Mining only
High grade B-cell lymphoma with MYC and/ or BCL2 and/or BCL6 rearrangement	High Grade B-Cell Lymphoma With MYC And/ Or BCL2 And/Or BCL6 Rearrangement	Orphanet			★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	CTD_human_DG	25543051		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	11238128, 11290603, 12393409, 16049307, 19465900, 21424034, 24326827, 24678684, 9310496, 9746758	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11290603, 11742039, 15339680, 15982329, 16733207, 18628087, 24761809, 26565895, 7472775, 7742550, 8527378, 8555467, 8618432, 8758205, 9006332, 9019154, 9096701, 9160681, 9209651, 9359519, 9504630, 9746758		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	15339680		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	10090942, 11290603	Associate	★☆☆☆☆ Found in Text Mining only
Hyper-Immunoglobulin E Syndrome, Autosomal Dominant	STAT3 Deficiency	BEFREE	29042531		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	9746767	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30805081		★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	30832685	Associate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	29319368		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30140283		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	25561904		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	11897040, 9684278		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	27222232, 29126613	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	16773719	Associate	★☆☆☆☆ Found in Text Mining only
Intravascular large B-cell lymphoma	Intravascular Large B-Cell Lymphoma	Orphanet			★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	29397940, 9332331, 9892104		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	9209652		★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	21725042		★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	21725042		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10803511, 19535347, 21911423, 22025499, 23169640, 25780007		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19535347, 23107779, 28030830	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	10627476	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31085557, 37634473	Associate	★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	21725042		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26928313		★☆☆☆☆ Found in Text Mining only
Low Grade Lymphoma (neoplasm)	Low Grade Lymphoma	CTD_human_DG	25543051		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	34321419	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	15153535	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32234966	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	31431691, 32245990	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	27818202, 28811467		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	25780007, 30178847		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10090923, 10233417, 10414499, 10626250, 10666217, 10764139, 10803511, 10923927, 10936424, 11106080, 11380473, 11420458, 11598170, 11742039, 11821949, 12124346, 12191569, 12217802, 12399977, 12399978, 12515714, 12775568, 12835729, 12881702, 14513282, 14654791, 15252312, 15375218, 15377470, 15611242, 15655367, 16019457, 16094416, 16331266, 16728698, 16733216, 16799010, 16815642, 17468402, 17951530, 17963508, 18451163, 19298719, 19525926, 19535347, 20032416, 20605493, 21083654, 21119107, 21502424, 22113614, 22451912, 22493480, 23348205, 23708665, 23795761, 23910958, 24179151, 24362533, 24679006, 24698494, 25557390, 25640395, 25696840, 25827211, 26158410, 26224092, 26657288, 26892631, 27268052, 27505670, 27717585, 27821509, 27921272, 28589362, 28614202, 28711572, 28844114, 29154209, 29262721, 29629947, 29666005, 29722657, 29785017, 29902576, 30082494, 30213388, 30496802, 30734478, 30874354, 31063496, 31288832, 31615842, 31693188, 7472775, 8167331, 8208268, 8220427, 8527378, 8555467, 8695812, 8703825, 8951602, 9184180, 9398863, 9401082, 9402330, 9680371, 9720713, 9746767, 9824205, 9892104		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10090923, 10666217, 10887128, 10898795, 11380473, 11943722, 12406872, 12515714, 12738680, 14655758, 16400323, 16494623, 16507780, 16728698, 16778825, 17545502, 17963508, 17999414, 18212045, 18451163, 18645192, 19525926, 19535347, 20032416, 20533006, 20733034, 20966935, 22041376, 22918164, 23341189, 23600716, 23795761, 24179151, 24362533, 24595451, 24625454, 24943107, 25038272, 25612555, 25640395, 25817328, 25991819, 26565895, 26702065, 27419806, 27764808, 28061782, 28771100, 28776574, 28930682, 29785017, 30181564, 30235749, 30348671, 30918199, 31171907, 31365872, 31419226, 31556696, 31712669, 31805190, 31997133, 32311849, 32362635, 33530253, 33551436, 33591648, 33786907, 34381423, 34608246, 34707037, 35895386, 39905397, 40651974, 8167331, 8547655, 9395180, 9401082, 9504630, 9617870, 9680371, 9746767	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	11920179, 12217802, 12469325, 16772602, 16819511, 17360630, 17468402, 17558410		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	10627476, 10666217, 10702417, 11290603, 12529293, 12738680, 15098010, 15277222, 15723651, 16728698, 17138820, 17296585, 17387393, 18264083, 18500267, 18925696, 19465899, 19549844, 20032416, 21988858, 25400800, 27513891, 28038709, 28324774, 28765546, 30348636, 31776129, 33211828, 33768318, 34601504, 34788985, 36575003, 37561599, 7795255, 8618933, 9427715	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Diffuse	Lymphoma	CTD_human_DG	25543051		★☆☆☆☆ Found in Text Mining only
Lymphoma, Diffuse	Lymphoma	BEFREE	9200999		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	10347555, 10414499, 10666217, 10702417, 10825742, 10887128, 11106080, 11353050, 11567225, 11780315, 11911418, 12200704, 12217802, 12399977, 12399978, 12405909, 12406872, 12430874, 12529293, 12738680, 15098010, 15277222, 15377470, 15500654, 15723651, 15815725, 15875184, 16019457, 16075463, 16094416, 16125304, 16147992, 16194898, 16647949, 16728698, 16772123, 17088997, 17138820, 17175383, 17295647, 17296585, 17981218, 18180034, 18203018, 18500267, 18628087, 19465899, 19549844, 20032416, 21502424, 21659362, 21855110, 22914613, 22968395, 23509938, 24778012, 25953460, 27513891, 28038709, 28232365, 28324774, 28594133, 28765546, 28984304, 29309299, 30213394, 31631728, 7742550, 7795255, 8618933, 8703825, 8758205, 9200999, 9209377, 9373196, 9427715, 9573674		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	LHGDN	15277222, 16094416, 16194898, 17296585, 18500267		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	ORPHANET_DG	22968395		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular, Grade 3	Lymphoma	BEFREE	18925696		★☆☆☆☆ Found in Text Mining only
Lymphoma, Intermediate-Grade	Intermediate Grade Lymphoma	CTD_human_DG	25543051		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	10953971, 11579468, 12835729, 18925696, 7794763, 8063612, 8618443		★☆☆☆☆ Found in Text Mining only
Lymphoma, Mixed-Cell	Lymphoma	CTD_human_DG	25543051		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	10637510, 10666217, 10803463, 10953971, 11175338, 11290603, 11368366, 11579468, 12173331, 12414651, 12469325, 12835729, 15024721, 15611930, 16125304, 16264183, 16331266, 16772123, 7794763, 8025268, 8063612, 8142643, 8167331, 8220427, 8255095, 8504412, 8618443, 8703825, 8780747, 8923787, 8988030, 9047392, 9096701, 9184180, 9209377, 9226377, 9373196, 9398863, 9402330, 9684278, 9747876, 9796700, 9824206		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	15024721, 16264183, 17576390		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	CTD_human_DG	25543051		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	10637510, 10666217, 10953971, 11290603, 11579468, 12414651, 12469325, 12835729, 15024721, 15611930, 16125304, 16264183, 16331266, 16772123, 7794763, 8025268, 8063612, 8142643, 8167331, 8618443, 8780747, 8923787, 8988030, 9047392, 9226377, 9398863, 9402330, 9747876, 9796700, 9824206		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	CTD_human_DG	25543051		★☆☆☆☆ Found in Text Mining only
Lymphoma, Small Noncleaved-Cell	Lymphoma	CTD_human_DG	25543051		★☆☆☆☆ Found in Text Mining only
Lymphoma, Small Noncleaved-Cell	Lymphoma	BEFREE	7742550, 8025268, 9209652		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	22493372		★☆☆☆☆ Found in Text Mining only
Lymphoma, Undifferentiated	Lymphoma	CTD_human_DG	25543051		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	12907442, 15153535, 18776761, 9746767	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	15153535, 21509436, 7577614, 9389359, 9746767		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	28356518		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	15252312, 28628241, 9200999		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12944904, 14654791, 16331266, 17963508, 19816083, 20124477, 23637631, 23708665, 23716595, 24282530, 24662818, 24917186, 26049022, 26096934, 28973975, 29104620, 29854311		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29434966		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28671040		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23637631		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19337254, 31227749		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27237631		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10803511, 11059755, 12469325, 14654791, 16819511, 19797725, 20385356, 21596365, 23341189, 23959583, 24917186, 27881582, 28232365, 28377453, 28485934, 28671040, 28875978, 28930682, 29393377, 30777872, 31085557, 8172819, 9096701, 9751748		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	21725042		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	10361135, 12399978, 12842981, 15252312, 28628241, 7742550, 9200999, 9402330		★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	10797525, 11146573, 14726817, 21502424, 30213394, 9332330		★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	ORPHANET_DG	17116487		★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	27124935		★☆☆☆☆ Found in Text Mining only
Mediastinal lymphadenopathy	Mediastinal lymphadenopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	14695333, 23637631		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	14695333	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	32002306	Stimulate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	25038272		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	25038272	Inhibit	★☆☆☆☆ Found in Text Mining only
Microphthalmia syndromic 2	Microphthalmia	Pubtator	22983184	Associate	★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	30610661		★☆☆☆☆ Found in Text Mining only
Monoclonal B-Cell Lymphocytosis	B-Cell Lymphocytosis	BEFREE	15370257		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	11120333, 11353050, 12766583, 15153535, 15609396, 16364768, 16484127, 16772602, 17122510, 18166802, 18445693, 20830719, 21502424, 22965301, 30213394, 31631728, 9395180, 9546062		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	LHGDN	15609396, 18166802		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	17149956, 19144381, 20228272, 26702068, 28476134, 28544233, 29510136, 8142643		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	20228272, 26763361, 28420429, 28544233, 29654271, 37406588, 9746767	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	35887298	Associate	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	22918164	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	21911423, 28368400, 28410239		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	38228864	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	36412101	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	34887247	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10564588, 10627476, 10666217, 10666379, 10811103, 11493437, 11781220, 11911418, 12173331, 12407182, 12766583, 12835729, 15277222, 15339680, 15363033, 15375218, 15377470, 15500654, 15577684, 15655367, 15716242, 16773719, 17360630, 17573669, 18203018, 18245479, 19816083, 20016842, 20299965, 21725042, 22451912, 22493480, 23269799, 23910958, 24222112, 24282530, 24678684, 24679006, 24778012, 24917186, 25090026, 25604350, 25780007, 26426741, 26448193, 26491211, 26573234, 27186677, 27237631, 27494852, 27815824, 27880939, 27881582, 28030830, 28296741, 28377453, 28671040, 29104620, 29262721, 29393377, 29408281, 29510377, 29861161, 29902576, 29969259, 30420967, 30613837, 31346987, 31754389, 7742550, 7795255, 8025268, 8063612, 8142643, 8555467, 8557040, 8703825, 8750627, 9006332, 9209377, 9209651, 9373196, 9568537, 9746758, 9751748, 9796700, 9824205, 9856677		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	25557390		★☆☆☆☆ Found in Text Mining only
Nodular Lymphocyte Predominant Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	12393409, 15339680, 16049307, 16856972, 24678684, 27998726		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26845350, 28377453, 29899834		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	20124477		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30566857		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	26096934		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	36781858	Associate	★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	30832685		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28440396		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	19701248		★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	LHGDN	17594153		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28671040		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26553360, 27240592, 28671040, 32412910, 34126157, 40076915	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15231651, 23637631		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	40294979	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	36593912	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal ventricular fibrillation	Paroxysmal ventricular fibrillation	Pubtator	29126613	Associate	★☆☆☆☆ Found in Text Mining only
Pelvic Inflammatory Disease	Pelvic inflammatory disease	Pubtator	36196757	Associate	★☆☆☆☆ Found in Text Mining only
Perineurioma	Perineurioma	BEFREE	21725042		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	40294979	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	30111286	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	11742039, 16341044, 27921272		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	HPO_DG			★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	30777872		★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	30777872		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	30103201, 31395741, 9427715		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	23494176, 25759025, 25780007, 28030830, 30178847, 31395741		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	10953971, 23637631		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	12387458, 12631608, 16896311, 18645192, 25038272, 30306208, 9680371		★☆☆☆☆ Found in Text Mining only
Primary mediastinal large B-cell lymphoma	Mediastinal B-Cell Lymphoma	Orphanet			★☆☆☆☆ Found in Text Mining only
Progesterone Resistance	Progesterone Resistance	BEFREE	28754906		★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	22267475		★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	12055673, 9209377		★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	CTD_human_DG	25543051		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	12414651		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29377743, 31019190		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	36482464	Stimulate	★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	30279226		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31401377		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	11897040		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	22918164	Associate	★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	30191661		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	22493372		★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	21725042		★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 11 autosomal recessive	Spastic paraplegia	Pubtator	17542409	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26986233, 36969496	Associate	★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30566857, 30983568		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31227749		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	15609396, 16772602, 9401082	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19337254, 29510377	Associate	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	21725042		★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	29848367		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	30279226, 30760472		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	12399978, 17468402, 22451912, 25557390		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	CTD_human_DG	15375218		★☆☆☆☆ Found in Text Mining only
T-Lymphocytopenia, Idiopathic CD4-Positive	Immunodeficiency	BEFREE	18166773		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27186677		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	27237631	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	27222232	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	21725042		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30140283		★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	27180090	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	26931436	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	36430854	Stimulate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	18670352		★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	27170596		★☆☆☆☆ Found in Text Mining only