Gene Gene information from NCBI Gene database.
Entrez ID 604
Gene name BCL6 transcription repressor
Gene symbol BCL6
Synonyms (NCBI Gene)
BCL5BCL6ALAZ3ZBTB27ZNF51
Chromosome 3
Chromosome location 3q27.3
Summary The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of STAT-dependent IL-4 resp
miRNA miRNA information provided by mirtarbase database.
157
miRTarBase ID miRNA Experiments Reference
MIRT000640 hsa-miR-9-5p Luciferase reporter assay 19956200
MIRT004463 hsa-miR-127-3p Luciferase reporter assay 17581274
MIRT004463 hsa-miR-127-3p Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot 16766263
MIRT004463 hsa-miR-127-3p Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot 16766263
MIRT005929 hsa-miR-339-5p qRT-PCR 20932331
Transcription factors Transcription factors information provided by TRRUST V2 database.
16
Transcription factor Regulation Reference
ABL1 Repression 15509806
BCL6 Repression 12407182
CTCF Repression 20733034
FOSL2 Activation 22493372
FOXO3 Activation 15509806
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
96
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 11929873
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 15577913, 16704730
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000902 Process Cell morphogenesis IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
109565 1001 ENSG00000113916
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P41182
Protein name B-cell lymphoma 6 protein (BCL-6) (B-cell lymphoma 5 protein) (BCL-5) (Protein LAZ-3) (Zinc finger and BTB domain-containing protein 27) (Zinc finger protein 51)
Protein function Transcriptional repressor mainly required for germinal center (GC) formation and antibody affinity maturation which has different mechanisms of action specific to the lineage and biological functions. Forms complexes with different corepressors
PDB 1R28 , 1R29 , 1R2B , 2EN2 , 2EOS , 2LCE , 2YRM , 3BIM , 3E4U , 3LBZ , 4CP3 , 4U2M , 5H7G , 5H7H , 5MW2 , 5MW6 , 5MWD , 5N1X , 5N1Z , 5N20 , 5N21 , 5X4M , 5X4N , 5X4O , 5X4P , 5X4Q , 5X9O , 5X9P , 6C3L , 6C3N , 6CQ1 , 6EW6 , 6EW7 , 6EW8 , 6TBT , 6TCJ , 6TOF , 6TOG , 6TOH , 6TOI , 6TOJ , 6TOK , 6TOL , 6TOM , 6TON , 6TOO , 6XMX , 6XWF , 6XXS , 6XYX , 6XZZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00651 BTB 22 129 BTB/POZ domain Domain
PF00096 zf-C2H2 546 568 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 574 596 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 602 624 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 630 652 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in germinal center T- and B-cells and in primary immature dendritic cells. {ECO:0000269|PubMed:10981963, ECO:0000269|PubMed:12402037, ECO:0000269|PubMed:15454082, ECO:0000269|PubMed:16142238, ECO:0000269|PubMed:16455075, ECO:
Sequence
MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSI
FTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDT
CRKFIKASE
AEMVSAIKPPREEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAF
APSLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVRMPVANPFPKERALPCDSARPVPG
EYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKAS
KEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASG
SPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEP
ENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGS
QSPQHAEMCLHTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQT
HSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEK
PYKCETCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHC
EKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPPELPKAC
Sequence length 706
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  FoxO signaling pathway
Transcriptional misregulation in cancer
Chemical carcinogenesis - receptor activation
  Interleukin-4 and Interleukin-13 signaling
TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain
FOXO-mediated transcription of cell death genes
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
5
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CHRONIC LEFT-SIDED ULCERATIVE COLITIS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
FOLLICULAR LYMPHOMA Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL HEMORRHAGE CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acquired Hypogammaglobulinemia Common Variable Immunodeficiency BEFREE 10923927
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 15370207, 19965641, 25759025, 25780007, 28030830, 30178847, 31395741
★☆☆☆☆
Found in Text Mining only
Acute Promyelocytic Leukemia Promyelocytic Leukemia BEFREE 11175338, 16996269
★☆☆☆☆
Found in Text Mining only
Acute Undifferentiated Leukemia Leukemia BEFREE 21911423
★☆☆☆☆
Found in Text Mining only
Adult Acute Lymphocytic Leukemia Lymphocytic Leukemia BEFREE 15370207, 19965641, 28030830
★☆☆☆☆
Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma B-cell Lymphoma BEFREE 10414499, 10482997, 10753856, 11023530, 11353050, 11493437, 11743658, 11821949, 11972514, 12389616, 12430874, 12515714, 12766583, 14979479, 15024721
View all (47 more)
★☆☆☆☆
Found in Text Mining only
Adult Hodgkin Lymphoma Hodgkin Lymphoma BEFREE 15339680, 15982329, 16733207
★☆☆☆☆
Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia T-Cell Lymphoma/Leukemia BEFREE 22493372
★☆☆☆☆
Found in Text Mining only
Adult type dermatomyositis Dermatomyositis BEFREE 27803134
★☆☆☆☆
Found in Text Mining only
Allergic rhinitis (disorder) Allergic rhinitis BEFREE 26472169
★☆☆☆☆
Found in Text Mining only