RNASE4 (ribonuclease A family member 4)

Gene

• Entrez ID: 6038
• Gene name: Ribonuclease A family member 4
• Gene symbol: RNASE4
• Synonyms (NCBI Gene): RAB1, RNS4
• Chromosome: 14
• Chromosome location: 14q11.2
• Summary: The protein encoded by this gene belongs to the pancreatic ribonuclease family. It plays an important role in mRNA cleavage and has marked specificity towards the 3` side of uridine nucleotides. Alternative splicing results in four transcript variants enc

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017156	hsa-miR-335-5p	Microarray	18185580
MIRT024338	hsa-miR-215-5p	Microarray	19074876
MIRT026275	hsa-miR-192-5p	Microarray	19074876
MIRT1308614	hsa-miR-3148	CLIP-seq
MIRT1308615	hsa-miR-3647-3p	CLIP-seq
MIRT1308616	hsa-miR-3973	CLIP-seq
MIRT1308617	hsa-miR-5095	CLIP-seq
MIRT1308618	hsa-miR-520g	CLIP-seq
MIRT1308619	hsa-miR-520h	CLIP-seq
MIRT1308620	hsa-miR-552	CLIP-seq
MIRT1308621	hsa-miR-556-3p	CLIP-seq
MIRT1308622	hsa-miR-561	CLIP-seq
MIRT1308623	hsa-miR-664	CLIP-seq
MIRT1308624	hsa-miR-873	CLIP-seq
MIRT1308625	hsa-miR-136	CLIP-seq
MIRT1308626	hsa-miR-3675-3p	CLIP-seq
MIRT1308617	hsa-miR-5095	CLIP-seq
MIRT1308620	hsa-miR-552	CLIP-seq
MIRT1308627	hsa-miR-654-3p	CLIP-seq
MIRT2612220	hsa-miR-302a	CLIP-seq
MIRT2612221	hsa-miR-302b	CLIP-seq
MIRT2612222	hsa-miR-302c	CLIP-seq
MIRT2612223	hsa-miR-302d	CLIP-seq
MIRT2612224	hsa-miR-302e	CLIP-seq
MIRT2612225	hsa-miR-372	CLIP-seq
MIRT2612226	hsa-miR-373	CLIP-seq
MIRT2612227	hsa-miR-3913-3p	CLIP-seq
MIRT2612228	hsa-miR-4528	CLIP-seq
MIRT2612229	hsa-miR-4536	CLIP-seq
MIRT2612230	hsa-miR-489	CLIP-seq
MIRT2612231	hsa-miR-512-3p	CLIP-seq
MIRT2612232	hsa-miR-519a	CLIP-seq
MIRT2612233	hsa-miR-519b-3p	CLIP-seq
MIRT2612234	hsa-miR-519c-3p	CLIP-seq
MIRT2612235	hsa-miR-520a-3p	CLIP-seq
MIRT2612236	hsa-miR-520b	CLIP-seq
MIRT2612237	hsa-miR-520c-3p	CLIP-seq
MIRT2612238	hsa-miR-520d-3p	CLIP-seq
MIRT2612239	hsa-miR-520e	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0004518	Function	Nuclease activity	IEA
GO:0004519	Function	Endonuclease activity	IEA
GO:0004522	Function	Ribonuclease A activity	NAS	7742370
GO:0004540	Function	RNA nuclease activity	IBA
GO:0004540	Function	RNA nuclease activity	IDA	3467790
GO:0005576	Component	Extracellular region	IDA	3467790
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	3467790, 33818125
GO:0016787	Function	Hydrolase activity	IEA
GO:0019731	Process	Antibacterial humoral response	IMP	33818125
GO:0042742	Process	Defense response to bacterium	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA

Other IDs

• MIM: 601030
• HGNC: 10047
• e!Ensembl: ENSG00000258818

Protein

• UniProt ID: P34096
• Protein name: Ribonuclease 4 (RNase 4) (EC 3.1.27.-)
• Protein function: Cleaves preferentially after uridine bases (PubMed:3467790). Has antimicrobial activity against uropathogenic E.coli (UPEC) (PubMed:33818125). Probably contributes to urinary tract sterility (PubMed:33818125). {ECO:0000269|PubMed:33818125, ECO:0
• PDB: 1RNF, 2RNF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00074	RnaseA	31 → 146	Pancreatic ribonuclease	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the cortical and medullary tubules of the kidney, and in the transitional epithelium of the urinary bladder (at protein level). {ECO:0000269|PubMed:30418175, ECO:0000269|PubMed:33818125}.
• Sequence:

  MALQRTHSLLLLLLLTLLGLGLVQPSYGQDGMYQRFLRQHVHPEETGGSDRYCNLMMQRR
  KMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNC
  RYRAIASTRRVVIACEGNPQVPVHFDG

• Sequence length: 147

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 10	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 9	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FRONTOTEMPORAL DEMENTIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	26298469, 29279004, 30544007, 31368019		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis 9	Amyotrophic lateral sclerosis	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	30530896	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28423658	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	27041585		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28423658		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28423658		★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	BEFREE	28883096		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	29328442		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	29328442	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	30530896	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16052224	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27998765		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27041585		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28423658		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30925905		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30925905	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	24659782	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28120477		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	16794039, 27041585		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin Neoplasms	BEFREE	30925905		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	30925905	Associate	★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	8838809		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28423658	Associate	★☆☆☆☆ Found in Text Mining only