Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	60343
Gene name	FAM3 metabolism regulating signaling molecule A
Gene symbol	FAM3A
Synonyms (NCBI Gene)	2.19DLDDXS560SXAP-7
Chromosome	X
Chromosome location	Xq28
Summary	This gene encodes a cytokine-like protein. The expression of this gene may be regulated by peroxisome proliferator-activated receptor gamma, and the encoded protein may be involved in the regulation of glucose and lipid metabolism. Alternative splicing re

Show/Hide all (92)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029626	hsa-miR-26b-5p	Microarray	19088304
MIRT049720	hsa-miR-92a-3p	CLASH	23622248
MIRT040766	hsa-miR-18a-3p	CLASH	23622248
MIRT731653	hsa-miR-423-5p	5.0	28411267
MIRT731653	hsa-miR-423-5p	5.0	28411267
MIRT984634	hsa-miR-1587	CLIP-seq
MIRT984635	hsa-miR-2278	CLIP-seq
MIRT984636	hsa-miR-2355-3p	CLIP-seq
MIRT984637	hsa-miR-3074-5p	CLIP-seq
MIRT984638	hsa-miR-3662	CLIP-seq
MIRT984639	hsa-miR-3667-3p	CLIP-seq
MIRT984640	hsa-miR-370	CLIP-seq
MIRT984641	hsa-miR-3915	CLIP-seq
MIRT984642	hsa-miR-3928	CLIP-seq
MIRT984643	hsa-miR-4328	CLIP-seq
MIRT984644	hsa-miR-4492	CLIP-seq
MIRT984645	hsa-miR-4498	CLIP-seq
MIRT984646	hsa-miR-4646-3p	CLIP-seq
MIRT984647	hsa-miR-4655-5p	CLIP-seq
MIRT984648	hsa-miR-4656	CLIP-seq
MIRT984649	hsa-miR-4663	CLIP-seq
MIRT984650	hsa-miR-4675	CLIP-seq
MIRT984651	hsa-miR-4690-5p	CLIP-seq
MIRT984652	hsa-miR-4724-5p	CLIP-seq
MIRT984653	hsa-miR-4741	CLIP-seq
MIRT984654	hsa-miR-4802-5p	CLIP-seq
MIRT984655	hsa-miR-762	CLIP-seq
MIRT984656	hsa-miR-765	CLIP-seq
MIRT984657	hsa-miR-1252	CLIP-seq
MIRT984658	hsa-miR-1273g	CLIP-seq
MIRT984659	hsa-miR-148a	CLIP-seq
MIRT984660	hsa-miR-148b	CLIP-seq
MIRT984661	hsa-miR-152	CLIP-seq
MIRT984662	hsa-miR-2277-3p	CLIP-seq
MIRT984663	hsa-miR-2467-3p	CLIP-seq
MIRT984664	hsa-miR-297	CLIP-seq
MIRT984665	hsa-miR-3120-3p	CLIP-seq
MIRT984666	hsa-miR-3138	CLIP-seq
MIRT984667	hsa-miR-3146	CLIP-seq
MIRT984668	hsa-miR-3149	CLIP-seq
MIRT984669	hsa-miR-3179	CLIP-seq
MIRT984670	hsa-miR-3201	CLIP-seq
MIRT984671	hsa-miR-3653	CLIP-seq
MIRT984638	hsa-miR-3662	CLIP-seq
MIRT984672	hsa-miR-3678-3p	CLIP-seq
MIRT984673	hsa-miR-3940-3p	CLIP-seq
MIRT984674	hsa-miR-4261	CLIP-seq
MIRT984675	hsa-miR-4791	CLIP-seq
MIRT984676	hsa-miR-4800-5p	CLIP-seq
MIRT984677	hsa-miR-4802-3p	CLIP-seq
MIRT984678	hsa-miR-490-5p	CLIP-seq
MIRT984679	hsa-miR-494	CLIP-seq
MIRT984680	hsa-miR-508-3p	CLIP-seq
MIRT984681	hsa-miR-561	CLIP-seq
MIRT984682	hsa-miR-563	CLIP-seq
MIRT984683	hsa-miR-759	CLIP-seq
MIRT984684	hsa-miR-760	CLIP-seq
MIRT984685	hsa-miR-875-3p	CLIP-seq
MIRT984657	hsa-miR-1252	CLIP-seq
MIRT2387842	hsa-miR-1207-5p	CLIP-seq
MIRT2387843	hsa-miR-1233	CLIP-seq
MIRT2387844	hsa-miR-2861	CLIP-seq
MIRT2387845	hsa-miR-4722-5p	CLIP-seq
MIRT2387846	hsa-miR-4736	CLIP-seq
MIRT2387847	hsa-miR-4763-3p	CLIP-seq
MIRT2529723	hsa-miR-128	CLIP-seq
MIRT2529724	hsa-miR-1299	CLIP-seq
MIRT984659	hsa-miR-148a	CLIP-seq
MIRT984660	hsa-miR-148b	CLIP-seq
MIRT984661	hsa-miR-152	CLIP-seq
MIRT984663	hsa-miR-2467-3p	CLIP-seq
MIRT2529725	hsa-miR-3154	CLIP-seq
MIRT2529726	hsa-miR-3184	CLIP-seq
MIRT984672	hsa-miR-3678-3p	CLIP-seq
MIRT984673	hsa-miR-3940-3p	CLIP-seq
MIRT984674	hsa-miR-4261	CLIP-seq
MIRT2529727	hsa-miR-4782-5p	CLIP-seq
MIRT984679	hsa-miR-494	CLIP-seq
MIRT2529728	hsa-miR-516b	CLIP-seq
MIRT2529729	hsa-miR-7	CLIP-seq
MIRT984683	hsa-miR-759	CLIP-seq
MIRT984685	hsa-miR-875-3p	CLIP-seq
MIRT984659	hsa-miR-148a	CLIP-seq
MIRT984660	hsa-miR-148b	CLIP-seq
MIRT984661	hsa-miR-152	CLIP-seq
MIRT984663	hsa-miR-2467-3p	CLIP-seq
MIRT984672	hsa-miR-3678-3p	CLIP-seq
MIRT984673	hsa-miR-3940-3p	CLIP-seq
MIRT984674	hsa-miR-4261	CLIP-seq
MIRT984679	hsa-miR-494	CLIP-seq
MIRT984683	hsa-miR-759	CLIP-seq
MIRT984685	hsa-miR-875-3p	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006754	Process	ATP biosynthetic process	IEA
GO:0007005	Process	Mitochondrion organization	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0010467	Process	Gene expression	IEA
GO:0019732	Process	Antifungal humoral response	IDA	18212107
GO:0030073	Process	Insulin secretion	IEA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0055074	Process	Calcium ion homeostasis	IEA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	18212107
GO:1905035	Process	Negative regulation of antifungal innate immune response	IDA	18212107

MIM	HGNC	e!Ensembl
300492	13749	ENSG00000071889

P98173

Protein name

Protein FAM3A (Cytokine-like protein 2-19)

Protein function

May act as a defensin against invading fungal microorganisms.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15711	ILEI	103 → 191	Interleukin-like EMT inducer	Domain

Tissue specificity

TISSUE SPECIFICITY: In similar amounts in testis, pancreas, adrenal, placenta, brain, fetal brain, liver, kidney, skeletal muscle and heart.

Sequence

MRLAGPLRIVVLVVSVGVTWIVVSILLGGPGSGFPRIQQLFTSPESSVTAAPRARKYKCG
LPQPCPEEHLAFRVVSGAANVIGPKICLEDKMLMSSVKDNVGRGLNIALVNGVSGELIEA
RAFDMWAGDVNDLLKFIRPLHEGTLVFVASYDDPATKMNEETRKLFSELGSRNAKELAFR
DSWVFVGAKGVQNKSPFEQHVKNSKHSNKYEGWPEALEMEGCIPRRSTAS

Sequence length

230

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	9083044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31208715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28515350, 29221790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	35144334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28411267, 29221790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28411267, 29221790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28411267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	31000420		★★★★★ ★☆☆☆☆ Found in Text Mining only

FAM3A (FAM3 metabolism regulating signaling molecule A)