BCL3 (BCL3 transcription coactivator)

Gene

• Entrez ID: 602
• Gene name: BCL3 transcription coactivator
• Gene symbol: BCL3
• Synonyms (NCBI Gene): BCL4, D19S37
• Chromosome: 19
• Chromosome location: 19q13.32
• Summary: This gene is a proto-oncogene candidate. It is identified by its translocation into the immunoglobulin alpha-locus in some cases of B-cell leukemia. The protein encoded by this gene contains seven ankyrin repeats, which are most closely related to those f

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006500	hsa-miR-125b-5p	Luciferase reporter assay	20658525
MIRT006500	hsa-miR-125b-5p	Luciferase reporter assay	20658525
MIRT006500	hsa-miR-125b-5p	Luciferase reporter assay	20658525
MIRT006500	hsa-miR-125b-5p	Luciferase reporter assay	20658525
MIRT030231	hsa-miR-26b-5p	Microarray	19088304
MIRT462839	hsa-miR-4426	PAR-CLIP	23592263
MIRT462838	hsa-miR-4647	PAR-CLIP	23592263
MIRT462837	hsa-miR-4662b	PAR-CLIP	23592263
MIRT462836	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT462835	hsa-miR-7161-3p	PAR-CLIP	23592263
MIRT462834	hsa-miR-4671-5p	PAR-CLIP	23592263
MIRT462833	hsa-miR-412-3p	PAR-CLIP	23592263
MIRT462832	hsa-miR-6754-3p	PAR-CLIP	23592263
MIRT462831	hsa-miR-6837-3p	PAR-CLIP	23592263
MIRT462830	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT462829	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT462828	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT462827	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT462826	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT462825	hsa-miR-4281	PAR-CLIP	23592263
MIRT462824	hsa-miR-7109-5p	PAR-CLIP	23592263
MIRT462823	hsa-miR-133a-3p	PAR-CLIP	23592263
MIRT200619	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT200620	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT462822	hsa-miR-3934-3p	PAR-CLIP	23592263
MIRT200622	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT200626	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT200627	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT200621	hsa-miR-6747-5p	PAR-CLIP	23592263
MIRT462821	hsa-miR-197-5p	PAR-CLIP	23592263
MIRT462820	hsa-miR-3132	PAR-CLIP	23592263
MIRT200623	hsa-miR-6772-5p	PAR-CLIP	23592263
MIRT200615	hsa-miR-3115	PAR-CLIP	23592263
MIRT252930	hsa-miR-4666b	PAR-CLIP	23592263
MIRT200614	hsa-miR-1229-5p	PAR-CLIP	23592263
MIRT462819	hsa-miR-3936	PAR-CLIP	23592263
MIRT252920	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT252921	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT252921	hsa-miR-19b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27572553
MIRT252921	hsa-miR-19b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27572553
MIRT200614	hsa-miR-1229-5p	PAR-CLIP	26701625
MIRT200614	hsa-miR-1229-5p	PAR-CLIP	26701625
MIRT200614	hsa-miR-1229-5p	PAR-CLIP	26701625
MIRT462821	hsa-miR-197-5p	PAR-CLIP	26701625
MIRT462821	hsa-miR-197-5p	PAR-CLIP	26701625
MIRT462821	hsa-miR-197-5p	PAR-CLIP	26701625
MIRT200615	hsa-miR-3115	PAR-CLIP	26701625
MIRT200615	hsa-miR-3115	PAR-CLIP	26701625
MIRT200615	hsa-miR-3115	PAR-CLIP	26701625
MIRT462820	hsa-miR-3132	PAR-CLIP	26701625
MIRT462820	hsa-miR-3132	PAR-CLIP	26701625
MIRT462820	hsa-miR-3132	PAR-CLIP	26701625
MIRT462827	hsa-miR-328-5p	PAR-CLIP	26701625
MIRT462822	hsa-miR-3934-3p	PAR-CLIP	26701625
MIRT462822	hsa-miR-3934-3p	PAR-CLIP	26701625
MIRT462822	hsa-miR-3934-3p	PAR-CLIP	26701625
MIRT462819	hsa-miR-3936	PAR-CLIP	26701625
MIRT462819	hsa-miR-3936	PAR-CLIP	26701625
MIRT462819	hsa-miR-3936	PAR-CLIP	26701625
MIRT252930	hsa-miR-4666b	PAR-CLIP	26701625
MIRT252930	hsa-miR-4666b	PAR-CLIP	26701625
MIRT462830	hsa-miR-486-3p	PAR-CLIP	26701625
MIRT200619	hsa-miR-5197-3p	PAR-CLIP	26701625
MIRT200619	hsa-miR-5197-3p	PAR-CLIP	26701625
MIRT200619	hsa-miR-5197-3p	PAR-CLIP	26701625
MIRT462836	hsa-miR-5586-3p	PAR-CLIP	26701625
MIRT200620	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT200620	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT200620	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT200621	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT200621	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT200621	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT200622	hsa-miR-6752-5p	PAR-CLIP	26701625
MIRT200622	hsa-miR-6752-5p	PAR-CLIP	26701625
MIRT200622	hsa-miR-6752-5p	PAR-CLIP	26701625
MIRT200623	hsa-miR-6772-5p	PAR-CLIP	26701625
MIRT200623	hsa-miR-6772-5p	PAR-CLIP	26701625
MIRT200623	hsa-miR-6772-5p	PAR-CLIP	26701625
MIRT462829	hsa-miR-6795-5p	PAR-CLIP	26701625
MIRT200626	hsa-miR-6842-5p	PAR-CLIP	26701625
MIRT200626	hsa-miR-6842-5p	PAR-CLIP	26701625
MIRT200626	hsa-miR-6842-5p	PAR-CLIP	26701625
MIRT462826	hsa-miR-6885-5p	PAR-CLIP	26701625
MIRT462828	hsa-miR-6887-5p	PAR-CLIP	26701625
MIRT462824	hsa-miR-7109-5p	PAR-CLIP	26701625
MIRT200627	hsa-miR-7110-5p	PAR-CLIP	26701625
MIRT200627	hsa-miR-7110-5p	PAR-CLIP	26701625
MIRT200627	hsa-miR-7110-5p	PAR-CLIP	26701625
MIRT462839	hsa-miR-4426	PAR-CLIP	23592263
MIRT462838	hsa-miR-4647	PAR-CLIP	23592263
MIRT462837	hsa-miR-4662b	PAR-CLIP	23592263
MIRT462836	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT462835	hsa-miR-7161-3p	PAR-CLIP	23592263
MIRT462834	hsa-miR-4671-5p	PAR-CLIP	23592263
MIRT462833	hsa-miR-412-3p	PAR-CLIP	23592263
MIRT462832	hsa-miR-6754-3p	PAR-CLIP	23592263
MIRT462831	hsa-miR-6837-3p	PAR-CLIP	23592263
MIRT462830	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT462829	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT462828	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT462827	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT462826	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT462825	hsa-miR-4281	PAR-CLIP	23592263
MIRT462824	hsa-miR-7109-5p	PAR-CLIP	23592263
MIRT462823	hsa-miR-133a-3p	PAR-CLIP	23592263
MIRT200619	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT200620	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT462822	hsa-miR-3934-3p	PAR-CLIP	23592263
MIRT200622	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT200626	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT200627	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT200621	hsa-miR-6747-5p	PAR-CLIP	23592263
MIRT462821	hsa-miR-197-5p	PAR-CLIP	23592263
MIRT462820	hsa-miR-3132	PAR-CLIP	23592263
MIRT200623	hsa-miR-6772-5p	PAR-CLIP	23592263
MIRT200615	hsa-miR-3115	PAR-CLIP	23592263
MIRT252930	hsa-miR-4666b	PAR-CLIP	23592263
MIRT200614	hsa-miR-1229-5p	PAR-CLIP	23592263
MIRT462819	hsa-miR-3936	PAR-CLIP	23592263
MIRT819325	hsa-miR-1207-5p	CLIP-seq
MIRT819326	hsa-miR-1224-3p	CLIP-seq
MIRT819327	hsa-miR-1256	CLIP-seq
MIRT819328	hsa-miR-1273f	CLIP-seq
MIRT819329	hsa-miR-1275	CLIP-seq
MIRT819330	hsa-miR-128	CLIP-seq
MIRT819331	hsa-miR-1343	CLIP-seq
MIRT819332	hsa-miR-1909	CLIP-seq
MIRT819333	hsa-miR-1973	CLIP-seq
MIRT819334	hsa-miR-19a	CLIP-seq
MIRT819335	hsa-miR-19b	CLIP-seq
MIRT819336	hsa-miR-218	CLIP-seq
MIRT819337	hsa-miR-27a	CLIP-seq
MIRT819338	hsa-miR-27b	CLIP-seq
MIRT819339	hsa-miR-296-3p	CLIP-seq
MIRT819340	hsa-miR-3154	CLIP-seq
MIRT819341	hsa-miR-3180-5p	CLIP-seq
MIRT819342	hsa-miR-3182	CLIP-seq
MIRT819343	hsa-miR-3192	CLIP-seq
MIRT819344	hsa-miR-3199	CLIP-seq
MIRT819345	hsa-miR-3687	CLIP-seq
MIRT819346	hsa-miR-3689a-3p	CLIP-seq
MIRT819347	hsa-miR-3689c	CLIP-seq
MIRT819348	hsa-miR-412	CLIP-seq
MIRT819349	hsa-miR-4251	CLIP-seq
MIRT819350	hsa-miR-4324	CLIP-seq
MIRT819351	hsa-miR-4419a	CLIP-seq
MIRT819352	hsa-miR-4436b-3p	CLIP-seq
MIRT819353	hsa-miR-4442	CLIP-seq
MIRT819354	hsa-miR-4451	CLIP-seq
MIRT819355	hsa-miR-4454	CLIP-seq
MIRT819356	hsa-miR-4510	CLIP-seq
MIRT819357	hsa-miR-4515	CLIP-seq
MIRT819358	hsa-miR-4525	CLIP-seq
MIRT819359	hsa-miR-4665-5p	CLIP-seq
MIRT819360	hsa-miR-4667-3p	CLIP-seq
MIRT819361	hsa-miR-4687-3p	CLIP-seq
MIRT819362	hsa-miR-4693-3p	CLIP-seq
MIRT819363	hsa-miR-4698	CLIP-seq
MIRT819364	hsa-miR-4720-3p	CLIP-seq
MIRT819365	hsa-miR-4723-5p	CLIP-seq
MIRT819366	hsa-miR-4728-5p	CLIP-seq
MIRT819367	hsa-miR-4731-5p	CLIP-seq
MIRT819368	hsa-miR-4763-3p	CLIP-seq
MIRT819369	hsa-miR-4804-3p	CLIP-seq
MIRT819370	hsa-miR-513a-5p	CLIP-seq
MIRT819371	hsa-miR-520a-5p	CLIP-seq
MIRT819372	hsa-miR-520d-5p	CLIP-seq
MIRT819373	hsa-miR-524-5p	CLIP-seq
MIRT819374	hsa-miR-525-5p	CLIP-seq
MIRT819375	hsa-miR-548q	CLIP-seq
MIRT819376	hsa-miR-550a	CLIP-seq
MIRT819377	hsa-miR-556-3p	CLIP-seq
MIRT819378	hsa-miR-563	CLIP-seq
MIRT819379	hsa-miR-580	CLIP-seq
MIRT819380	hsa-miR-615-5p	CLIP-seq
MIRT819381	hsa-miR-625	CLIP-seq
MIRT819382	hsa-miR-636	CLIP-seq
MIRT819343	hsa-miR-3192	CLIP-seq
MIRT819346	hsa-miR-3689a-3p	CLIP-seq
MIRT819347	hsa-miR-3689c	CLIP-seq
MIRT819366	hsa-miR-4728-5p	CLIP-seq
MIRT819325	hsa-miR-1207-5p	CLIP-seq
MIRT819326	hsa-miR-1224-3p	CLIP-seq
MIRT819328	hsa-miR-1273f	CLIP-seq
MIRT819329	hsa-miR-1275	CLIP-seq
MIRT819330	hsa-miR-128	CLIP-seq
MIRT819331	hsa-miR-1343	CLIP-seq
MIRT819332	hsa-miR-1909	CLIP-seq
MIRT819333	hsa-miR-1973	CLIP-seq
MIRT819337	hsa-miR-27a	CLIP-seq
MIRT819338	hsa-miR-27b	CLIP-seq
MIRT819339	hsa-miR-296-3p	CLIP-seq
MIRT1942118	hsa-miR-296-5p	CLIP-seq
MIRT819340	hsa-miR-3154	CLIP-seq
MIRT1942119	hsa-miR-3156-5p	CLIP-seq
MIRT819341	hsa-miR-3180-5p	CLIP-seq
MIRT819343	hsa-miR-3192	CLIP-seq
MIRT819344	hsa-miR-3199	CLIP-seq
MIRT819346	hsa-miR-3689a-3p	CLIP-seq
MIRT819347	hsa-miR-3689c	CLIP-seq
MIRT819349	hsa-miR-4251	CLIP-seq
MIRT819350	hsa-miR-4324	CLIP-seq
MIRT819351	hsa-miR-4419a	CLIP-seq
MIRT819352	hsa-miR-4436b-3p	CLIP-seq
MIRT819355	hsa-miR-4454	CLIP-seq
MIRT819356	hsa-miR-4510	CLIP-seq
MIRT819357	hsa-miR-4515	CLIP-seq
MIRT819358	hsa-miR-4525	CLIP-seq
MIRT819359	hsa-miR-4665-5p	CLIP-seq
MIRT819360	hsa-miR-4667-3p	CLIP-seq
MIRT819365	hsa-miR-4723-5p	CLIP-seq
MIRT819366	hsa-miR-4728-5p	CLIP-seq
MIRT819367	hsa-miR-4731-5p	CLIP-seq
MIRT1942120	hsa-miR-4749-3p	CLIP-seq
MIRT819368	hsa-miR-4763-3p	CLIP-seq
MIRT819370	hsa-miR-513a-5p	CLIP-seq
MIRT819371	hsa-miR-520a-5p	CLIP-seq
MIRT819374	hsa-miR-525-5p	CLIP-seq
MIRT819375	hsa-miR-548q	CLIP-seq
MIRT819376	hsa-miR-550a	CLIP-seq
MIRT819378	hsa-miR-563	CLIP-seq
MIRT819379	hsa-miR-580	CLIP-seq
MIRT819380	hsa-miR-615-5p	CLIP-seq
MIRT819381	hsa-miR-625	CLIP-seq
MIRT819325	hsa-miR-1207-5p	CLIP-seq
MIRT819326	hsa-miR-1224-3p	CLIP-seq
MIRT819327	hsa-miR-1256	CLIP-seq
MIRT819328	hsa-miR-1273f	CLIP-seq
MIRT819329	hsa-miR-1275	CLIP-seq
MIRT819330	hsa-miR-128	CLIP-seq
MIRT2180987	hsa-miR-1293	CLIP-seq
MIRT819331	hsa-miR-1343	CLIP-seq
MIRT819332	hsa-miR-1909	CLIP-seq
MIRT819333	hsa-miR-1973	CLIP-seq
MIRT819334	hsa-miR-19a	CLIP-seq
MIRT819335	hsa-miR-19b	CLIP-seq
MIRT819336	hsa-miR-218	CLIP-seq
MIRT819337	hsa-miR-27a	CLIP-seq
MIRT819338	hsa-miR-27b	CLIP-seq
MIRT819339	hsa-miR-296-3p	CLIP-seq
MIRT1942118	hsa-miR-296-5p	CLIP-seq
MIRT2180988	hsa-miR-299-3p	CLIP-seq
MIRT2180989	hsa-miR-3126-3p	CLIP-seq
MIRT819340	hsa-miR-3154	CLIP-seq
MIRT1942119	hsa-miR-3156-5p	CLIP-seq
MIRT819341	hsa-miR-3180-5p	CLIP-seq
MIRT819342	hsa-miR-3182	CLIP-seq
MIRT819343	hsa-miR-3192	CLIP-seq
MIRT819344	hsa-miR-3199	CLIP-seq
MIRT819345	hsa-miR-3687	CLIP-seq
MIRT2180990	hsa-miR-3688-3p	CLIP-seq
MIRT819346	hsa-miR-3689a-3p	CLIP-seq
MIRT819347	hsa-miR-3689c	CLIP-seq
MIRT819348	hsa-miR-412	CLIP-seq
MIRT819349	hsa-miR-4251	CLIP-seq
MIRT819350	hsa-miR-4324	CLIP-seq
MIRT819351	hsa-miR-4419a	CLIP-seq
MIRT819352	hsa-miR-4436b-3p	CLIP-seq
MIRT819353	hsa-miR-4442	CLIP-seq
MIRT819355	hsa-miR-4454	CLIP-seq
MIRT2180991	hsa-miR-4483	CLIP-seq
MIRT819356	hsa-miR-4510	CLIP-seq
MIRT819357	hsa-miR-4515	CLIP-seq
MIRT819358	hsa-miR-4525	CLIP-seq
MIRT819359	hsa-miR-4665-5p	CLIP-seq
MIRT819360	hsa-miR-4667-3p	CLIP-seq
MIRT2180992	hsa-miR-4694-3p	CLIP-seq
MIRT819363	hsa-miR-4698	CLIP-seq
MIRT819364	hsa-miR-4720-3p	CLIP-seq
MIRT819365	hsa-miR-4723-5p	CLIP-seq
MIRT819366	hsa-miR-4728-5p	CLIP-seq
MIRT819367	hsa-miR-4731-5p	CLIP-seq
MIRT1942120	hsa-miR-4749-3p	CLIP-seq
MIRT819368	hsa-miR-4763-3p	CLIP-seq
MIRT2180993	hsa-miR-4802-3p	CLIP-seq
MIRT819369	hsa-miR-4804-3p	CLIP-seq
MIRT819370	hsa-miR-513a-5p	CLIP-seq
MIRT819371	hsa-miR-520a-5p	CLIP-seq
MIRT819374	hsa-miR-525-5p	CLIP-seq
MIRT819375	hsa-miR-548q	CLIP-seq
MIRT819376	hsa-miR-550a	CLIP-seq
MIRT819378	hsa-miR-563	CLIP-seq
MIRT2180994	hsa-miR-576-3p	CLIP-seq
MIRT819379	hsa-miR-580	CLIP-seq
MIRT819380	hsa-miR-615-5p	CLIP-seq
MIRT819381	hsa-miR-625	CLIP-seq
MIRT819382	hsa-miR-636	CLIP-seq
MIRT2180995	hsa-miR-7	CLIP-seq
MIRT2180996	hsa-miR-935	CLIP-seq
MIRT819325	hsa-miR-1207-5p	CLIP-seq
MIRT819332	hsa-miR-1909	CLIP-seq
MIRT819352	hsa-miR-4436b-3p	CLIP-seq
MIRT819368	hsa-miR-4763-3p	CLIP-seq
MIRT819325	hsa-miR-1207-5p	CLIP-seq
MIRT819332	hsa-miR-1909	CLIP-seq
MIRT1942118	hsa-miR-296-5p	CLIP-seq
MIRT819352	hsa-miR-4436b-3p	CLIP-seq
MIRT819360	hsa-miR-4667-3p	CLIP-seq
MIRT1942120	hsa-miR-4749-3p	CLIP-seq
MIRT819368	hsa-miR-4763-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	11387332
RELA	Activation	11387332
TP53	Repression	12808109

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001818	Process	Negative regulation of cytokine production	IEA
GO:0002268	Process	Follicular dendritic cell differentiation	IEA
GO:0002315	Process	Marginal zone B cell differentiation	IEA
GO:0002455	Process	Humoral immune response mediated by circulating immunoglobulin	IEA
GO:0002467	Process	Germinal center formation	IEA
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0003714	Function	Transcription corepressor activity	IDA	16306601
GO:0005515	Function	Protein binding	IPI	10362352, 16099425, 16280327, 21988832, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	8196632, 16280327, 16306601
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	11387332
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006606	Process	Protein import into nucleus	IDA	8196632
GO:0006915	Process	Apoptotic process	IEA
GO:0006950	Process	Response to stress	IEA
GO:0006974	Process	DNA damage response	IDA	16384933
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	8196632
GO:0009615	Process	Response to virus	IDA	16306601
GO:0010225	Process	Response to UV-C	IDA	16384933
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0019730	Process	Antimicrobial humoral response	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	IMP	16384933
GO:0030496	Component	Midbody	IDA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	16306601
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IDA	16306601
GO:0032717	Process	Negative regulation of interleukin-8 production	IMP	16306601
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	IEA
GO:0032991	Component	Protein-containing complex	IDA	16280327
GO:0032996	Component	Bcl3-Bcl10 complex	IDA	16280327
GO:0033257	Component	Bcl3/NF-kappaB2 complex	IBA
GO:0033257	Component	Bcl3/NF-kappaB2 complex	IDA	9407099
GO:0036064	Component	Ciliary basal body	IDA
GO:0042088	Process	T-helper 1 type immune response	IEA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IMP	16384933
GO:0042826	Function	Histone deacetylase binding	IBA
GO:0042826	Function	Histone deacetylase binding	IPI	16306601
GO:0042832	Process	Defense response to protozoan	IEA
GO:0042981	Process	Regulation of apoptotic process	IBA
GO:0042981	Process	Regulation of apoptotic process	IDA	16732314
GO:0043066	Process	Negative regulation of apoptotic process	IDA	16384933
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0045064	Process	T-helper 2 cell differentiation	IEA
GO:0045727	Process	Positive regulation of translation	IMP	16384933
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	16306601
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	16384933
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IMP	16306601
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048536	Process	Spleen development	IEA
GO:0051101	Process	Regulation of DNA binding	IEP	9407099
GO:0051707	Process	Response to other organism	IEA
GO:0070231	Process	T cell apoptotic process	IEA
GO:0070233	Process	Negative regulation of T cell apoptotic process	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IBA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	8196632, 11387332, 16108830, 16306601
GO:1901222	Process	Regulation of non-canonical NF-kappaB signal transduction	IEP	8196632

Other IDs

• MIM: 109560
• HGNC: 998
• e!Ensembl: ENSG00000069399

Protein

• UniProt ID: P20749
• Protein name: B-cell lymphoma 3 protein (BCL-3) (Proto-oncogene BCL3)
• Protein function: Contributes to the regulation of transcriptional activation of NF-kappa-B target genes. In the cytoplasm, inhibits the nuclear translocation of the NF-kappa-B p50 subunit. In the nucleus, acts as transcriptional activator that promotes transcrip
• PDB: 1K1A, 1K1B
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00023	Ank	134 → 170	Ankyrin repeat	Repeat
  PF00023	Ank	172 → 203	Ankyrin repeat	Repeat
  PF00023	Ank	241 → 273	Ankyrin repeat	Repeat
  PF00023	Ank	275 → 306	Ankyrin repeat	Repeat

• Sequence:

  MPRCPAGAMDEGPVDLRTRPKAAGLPGAALPLRKRPLRAPSPEPAAPRGAAGLVVPLDPL
  RGGCDLPAVPGPPHGLARPEALYYPGALLPLYPTRAMGSPFPLVNLPTPLYPMMCPMEHP
  LSADIAMATRADEDGDTPLHIAVVQGNLPAVHRLVNLFQQGGRELDIYNNLRQTPLHLAV
  ITTLPSVVRLLVTAGASPMALDRHGQTAAHLACEHRSPTCLRALLDSAAPGTLDLEARNY
  DGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGA
  NVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRG
  KATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPSSSPSQSPPRDPPGFPMAPPN
  FFLPSPSPPAFLPFAGVLRGPGRPVPPSPAPGGS

• Sequence length: 454

Pathways

KEGG:

C-type lectin receptor signaling pathway
TNF signaling pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BARRETT'S ESOPHAGUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGESTIVE SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLIPIDEMIAS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL HYPERLIPIDEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute pancreatitis	Pancreatitis	BEFREE	26526716		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	29473241		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	26033966		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	21752100		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	19734903, 21460841, 22832961, 24755620		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	29777097, 30617256, 30805717		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	20731879	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	25374339		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30753680	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	25374339		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	25374339		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23190644		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	11672772, 16426923, 21891868, 23562784, 30021393, 30792270, 31109623, 8374527		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	12456498, 16533741, 17495977, 2243504, 8136271		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	29473241		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	29473241	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	9885253	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	29287594	Associate	★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	29287594		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10496350, 10713699, 12972607, 27906182		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26515727, 29287594, 29339359, 35020071	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20414006	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31937236	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27779101	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20658525, 25944662, 30135206		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	25884818	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	25374339		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	9264393		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	30357752		★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	BEFREE	26526716		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	26526716		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29228604		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12040429, 12153169, 12456498, 1560313, 15716244, 16426923, 16533741, 17129229, 17495977, 17638669, 1923524, 2180580, 22195643, 2243504, 22580608, 25922067, 26062845, 2682663, 27572553, 30357752, 30575108, 8011990, 8136271, 8196632, 8255106, 9694711		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	26882953		★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	15054400, 15533211		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	19229118, 7668251	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	23607276, 28452361		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26033966, 29973688, 30792270		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20414006, 25929479, 30792270	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32355204	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	17129229, 21502423		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28355355		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	25374339		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	20601676, 23607276, 26462859		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	23607276		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	19282837	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	19809421	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	19282837, 19809421		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	14556665, 21752100, 2243504, 27873317		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	29670124		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	CTD_human_DG	29670124		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	Pubtator	29670124	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eczema	Eczema	BEFREE	19282837, 19809421		★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	22832488	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27748795, 29973405		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29973405, 31390836, 35488886	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27748795		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27748795, 29973405		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29973405	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	22195643, 26122346		★☆☆☆☆ Found in Text Mining only
Hemophagocytic Syndrome	Hemophagocytic Syndrome	BEFREE	11672772		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	12153169, 12456498, 12835724, 15716244, 16533741, 8011990		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	12456498, 15105810, 16123212, 18940474		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	15105810, 16123212, 21385932	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	23607276, 28452361		★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	25884818		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	12456498, 16108830, 16123212, 16533741		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	LHGDN	12456498, 16123212		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28684863		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28684863		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	1501714, 8400234		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20731879	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30357752	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30357752		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	16998793		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26882953, 28915576, 31793036		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	26882953		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	11672772		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	16108830		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	37560801	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	8400234		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	15105810, 8400234	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	1923524, 2243504, 8400234		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	16123212		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	2243504		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	2243504		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	10830747, 16418595, 8824724, 9078289		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	16418595	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10496350, 10713699, 12897145, 12972607, 27906182		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	16998793		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20658525, 25944662, 30135206		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22580608		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17495977, 21502423, 22580608, 23149915, 26122346, 26882953, 28915576, 30289427, 30792270, 8400234, 8548734, 9290956		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10713699, 27906182		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18668140, 39327470	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	22469839		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	34088830	Associate	★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	27873317		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19191868		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	19191868, 37610069	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28598502		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	15105810	Associate	★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	10830747		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28355355		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	7858174, 8279459		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	14678988, 17626640, 23868181		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	17626640, 18367518	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15716244, 16533741, 16713561, 17129229, 17495977, 18008375, 1923524, 2243504, 23149915, 26033966, 26122346, 26882953, 27748795, 27873317, 30792270, 8400234		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	34312772	Stimulate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26122346, 31586084		★☆☆☆☆ Found in Text Mining only
OROFACIAL CLEFT 1	Orofacial Cleft	BEFREE	17272867, 9722939		★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	7668251	Associate	★☆☆☆☆ Found in Text Mining only
OTOFACIOCERVICAL SYNDROME 1	Otofaciocervical Syndrome	BEFREE	17272867, 9722939		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	20658525, 25944662, 30135206		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30135206, 37151134	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	16123212		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	24293610		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	26526716		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22580608		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28901004		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29228604		★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	29774124		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	2009372		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	26138292		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	28901004		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	16123212		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	34315405	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30289427		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30289427	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	26462859		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	20974051	Associate	★☆☆☆☆ Found in Text Mining only