RING1 (ring finger protein 1)

Gene

• Entrez ID: 6015
• Gene name: Ring finger protein 1
• Gene symbol: RING1
• Synonyms (NCBI Gene): RING1A, RNF1
• Chromosome: 6
• Chromosome location: 6p21.32
• Summary: This gene belongs to the RING finger family, members of which encode proteins characterized by a RING domain, a zinc-binding motif related to the zinc finger domain. The gene product can bind DNA and can act as a transcriptional repressor. It is associate

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020727	hsa-miR-155-5p	Proteomics	18668040
MIRT042052	hsa-miR-484	CLASH	23622248
MIRT2315812	hsa-miR-1197	CLIP-seq
MIRT2315813	hsa-miR-1275	CLIP-seq
MIRT2315814	hsa-miR-1587	CLIP-seq
MIRT2315815	hsa-miR-320e	CLIP-seq
MIRT2315816	hsa-miR-342-5p	CLIP-seq
MIRT2315817	hsa-miR-3652	CLIP-seq
MIRT2315818	hsa-miR-378g	CLIP-seq
MIRT2315819	hsa-miR-4430	CLIP-seq
MIRT2315820	hsa-miR-4436a	CLIP-seq
MIRT2315821	hsa-miR-4492	CLIP-seq
MIRT2315822	hsa-miR-4498	CLIP-seq
MIRT2315823	hsa-miR-4505	CLIP-seq
MIRT2315824	hsa-miR-4525	CLIP-seq
MIRT2315825	hsa-miR-4651	CLIP-seq
MIRT2315826	hsa-miR-4656	CLIP-seq
MIRT2315827	hsa-miR-4664-5p	CLIP-seq
MIRT2315828	hsa-miR-4665-5p	CLIP-seq
MIRT2315829	hsa-miR-4675	CLIP-seq
MIRT2315830	hsa-miR-4723-5p	CLIP-seq
MIRT2315831	hsa-miR-4731-5p	CLIP-seq
MIRT2315832	hsa-miR-4741	CLIP-seq
MIRT2315833	hsa-miR-608	CLIP-seq
MIRT2315834	hsa-miR-625	CLIP-seq
MIRT2315835	hsa-miR-637	CLIP-seq
MIRT2315836	hsa-miR-762	CLIP-seq
MIRT2315813	hsa-miR-1275	CLIP-seq
MIRT2315815	hsa-miR-320e	CLIP-seq
MIRT2315816	hsa-miR-342-5p	CLIP-seq
MIRT2315824	hsa-miR-4525	CLIP-seq
MIRT2315825	hsa-miR-4651	CLIP-seq
MIRT2315827	hsa-miR-4664-5p	CLIP-seq
MIRT2315828	hsa-miR-4665-5p	CLIP-seq
MIRT2315830	hsa-miR-4723-5p	CLIP-seq
MIRT2315831	hsa-miR-4731-5p	CLIP-seq
MIRT2315833	hsa-miR-608	CLIP-seq
MIRT2315834	hsa-miR-625	CLIP-seq
MIRT2315835	hsa-miR-637	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IBA
GO:0000151	Component	Ubiquitin ligase complex	IEA
GO:0001739	Component	Sex chromatin	IEA
GO:0003682	Function	Chromatin binding	IBA
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	15386022, 16189514, 16943429, 17070805, 19549727, 19636380, 20601937, 21282530, 21516116, 22493164, 22897849, 24981860, 25416956, 26496610, 27505670, 27705803, 28514442, 28839133, 29187402, 31839203, 32296183, 32814053, 33961781, 34316702, 35271311
GO:0005634	Component	Nucleus	IDA	9199346, 21282530
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IDA	16943429
GO:0008270	Function	Zinc ion binding	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016604	Component	Nuclear body	IEA
GO:0016607	Component	Nuclear speck	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031519	Component	PcG protein complex	IBA
GO:0031519	Component	PcG protein complex	IDA	16943429, 21282530
GO:0031519	Component	PcG protein complex	IEA
GO:0035102	Component	PRC1 complex	IDA	12167701, 19636380
GO:0035102	Component	PRC1 complex	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	9199346
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048593	Process	Camera-type eye morphogenesis	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0097027	Function	Ubiquitin-protein transferase activator activity	IEA

Other IDs

• MIM: 602045
• HGNC: 10018
• e!Ensembl: ENSG00000204227

Protein

• UniProt ID: Q06587
• Protein name: E3 ubiquitin-protein ligase RING1 (EC 2.3.2.27) (Polycomb complex protein RING1) (RING finger protein 1) (RING-type E3 ubiquitin transferase RING1) (Really interesting new gene 1 protein)
• Protein function: Constitutes one of the E3 ubiquitin-protein ligases that mediate monoubiquitination of 'Lys-119' of histone H2A, thereby playing a central role in histone code and gene regulation. H2A 'Lys-119' ubiquitination gives a specific tag for epigenetic
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00097	zf-C3HC4	48 → 87	Zinc finger, C3HC4 type (RING finger)	Domain
  PF16207	RAWUL	282 → 400	RAWUL domain RING finger- and WD40-associated ubiquitin-like	Domain

• Sequence:

  MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMT
  TKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAH
  QDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGE
  GDGEDVSSDSAPDSAPGPAPKRPRGGGAGGSSVGTGGGGTGGVGGGAGSEDSGDRGGTLG
  GGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLA
  LRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQ
  YTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK

• Sequence length: 406

Pathways

KEGG:

Polycomb repressive complex

Reactome:

Oxidative Stress Induced Senescence
SUMOylation of DNA damage response and repair proteins
SUMOylation of transcription cofactors
SUMOylation of chromatin organization proteins
SUMOylation of RNA binding proteins
RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known
Regulation of PTEN gene transcription
Transcriptional Regulation by E2F6

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	29371181		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	15470680		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26141041		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26141041	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26141041		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24414991		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	16528373	Inhibit	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	9199346	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29187402		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	38219048	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	33446692	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	17967832		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	15470680		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	22821932		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	22821932		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	23972212		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29371181, 31551439		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26141041, 31696964		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24414991	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	21148756		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	21148756		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24414991		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17134822, 24414991, 26141041		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26141041		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29187402, 31696964		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	11298590		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28832687		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	28832687	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	21125401, 29383137		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18551146, 24414991, 26141041, 28720707		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24414991, 31292221		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	9199346	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	26631732		★☆☆☆☆ Found in Text Mining only
Pauci-immune Glomerulonephritis associated with Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	BEFREE	17967832		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17134822, 24414991, 26141041		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17134822		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24414991, 26141041	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16528373		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	16528373	Inhibit	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18984978, 24414991, 26141041	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	24414991		★☆☆☆☆ Found in Text Mining only