Gene Gene information from NCBI Gene database.
Entrez ID 6004
Gene name Regulator of G protein signaling 16
Gene symbol RGS16
Synonyms (NCBI Gene)
A28-RGS14A28-RGS14PRGS-R
Chromosome 1
Chromosome location 1q25.3
Summary The protein encoded by this gene belongs to the `regulator of G protein signaling` family. It inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits. It also may play a role in regulating the kinetics of signaling in th
miRNA miRNA information provided by mirtarbase database.
388
miRTarBase ID miRNA Experiments Reference
MIRT017280 hsa-miR-335-5p Microarray 18185580
MIRT027511 hsa-miR-98-5p Microarray 19088304
MIRT048122 hsa-miR-197-3p CLASH 23622248
MIRT469304 hsa-miR-494-3p PAR-CLIP 23592263
MIRT469303 hsa-miR-4450 PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0003924 Function GTPase activity IEA
GO:0003924 Function GTPase activity TAS
GO:0005096 Function GTPase activator activity IDA 18434541
GO:0005096 Function GTPase activator activity IEA
GO:0005096 Function GTPase activator activity TAS 10747990
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602514 9997 ENSG00000143333
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O15492
Protein name Regulator of G-protein signaling 16 (RGS16) (A28-RGS14P) (Retinal-specific RGS) (RGS-r) (hRGS-r) (Retinally abundant regulator of G-protein signaling)
Protein function Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form (PubMed:11602604, PubMed:18434541). Play
PDB 2BT2 , 2IK8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00615 RGS 65 180 Regulator of G protein signaling domain Domain
Tissue specificity TISSUE SPECIFICITY: Abundantly expressed in retina with lower levels of expression in most other tissues.
Sequence
MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVL
GWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEE
FICSEAPKEVNIDHETHELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDL

AAQASAASATLSSCSLDEPSHT
Sequence length 202
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    G alpha (q) signalling events
G alpha (i) signalling events
G alpha (z) signalling events
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
INSOMNIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Bicuspid Aortic Valve Disease Bicuspid aortic valve Pubtator 36071494 Associate
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 19509421 Inhibit
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 26823172 Associate
★☆☆☆☆
Found in Text Mining only
Chondrosarcoma Chondrosarcoma Pubtator 26013170 Associate
★☆☆☆☆
Found in Text Mining only
Colitis Ulcerative Ulcerative colitis Pubtator 35830366 Stimulate
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 19760045
★☆☆☆☆
Found in Text Mining only
Dermatitis Contact Contact dermatitis Pubtator 33318199 Associate
★☆☆☆☆
Found in Text Mining only
Familial lichen amyloidosis Lichen amyloidosis BEFREE 27635024
★☆☆☆☆
Found in Text Mining only
Glioma Glioma Pubtator 32319728 Associate
★☆☆☆☆
Found in Text Mining only
Lymphatic Metastasis Lymphatic metastasis Pubtator 20571966 Inhibit
★☆☆☆☆
Found in Text Mining only