RGS12 (regulator of G protein signaling 12)

Gene

• Entrez ID: 6002
• Gene name: Regulator of G protein signaling 12
• Gene symbol: RGS12
• Synonyms (NCBI Gene): -
• Chromosome: 4
• Chromosome location: 4p16.3
• Summary: This gene encodes a member of the `regulator of G protein signaling` (RGS) gene family. The encoded protein may function as a guanosine triphosphatase (GTPase)-activating protein as well as a transcriptional repressor. This protein may play a role in tumo

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT045830	hsa-miR-138-5p	CLASH	23622248
MIRT045473	hsa-miR-149-5p	CLASH	23622248
MIRT716003	hsa-miR-4459	HITS-CLIP	19536157
MIRT716002	hsa-miR-665	HITS-CLIP	19536157
MIRT716001	hsa-miR-6840-3p	HITS-CLIP	19536157
MIRT716000	hsa-miR-1915-3p	HITS-CLIP	19536157
MIRT715999	hsa-miR-6764-5p	HITS-CLIP	19536157
MIRT715998	hsa-miR-4726-3p	HITS-CLIP	19536157
MIRT715997	hsa-miR-4532	HITS-CLIP	19536157
MIRT715996	hsa-miR-7704	HITS-CLIP	19536157
MIRT716003	hsa-miR-4459	HITS-CLIP	19536157
MIRT716002	hsa-miR-665	HITS-CLIP	19536157
MIRT716001	hsa-miR-6840-3p	HITS-CLIP	19536157
MIRT716000	hsa-miR-1915-3p	HITS-CLIP	19536157
MIRT715999	hsa-miR-6764-5p	HITS-CLIP	19536157
MIRT715998	hsa-miR-4726-3p	HITS-CLIP	19536157
MIRT715997	hsa-miR-4532	HITS-CLIP	19536157
MIRT715996	hsa-miR-7704	HITS-CLIP	19536157
MIRT1304102	hsa-miR-1197	CLIP-seq
MIRT1304103	hsa-miR-1266	CLIP-seq
MIRT1304104	hsa-miR-2467-3p	CLIP-seq
MIRT1304105	hsa-miR-3158-5p	CLIP-seq
MIRT1304106	hsa-miR-335	CLIP-seq
MIRT1304107	hsa-miR-3612	CLIP-seq
MIRT1304108	hsa-miR-365	CLIP-seq
MIRT1304109	hsa-miR-3664-3p	CLIP-seq
MIRT1304110	hsa-miR-3678-3p	CLIP-seq
MIRT1304111	hsa-miR-3680	CLIP-seq
MIRT1304112	hsa-miR-377	CLIP-seq
MIRT1304113	hsa-miR-4420	CLIP-seq
MIRT1304114	hsa-miR-4436a	CLIP-seq
MIRT1304115	hsa-miR-4443	CLIP-seq
MIRT1304116	hsa-miR-4518	CLIP-seq
MIRT1304117	hsa-miR-4651	CLIP-seq
MIRT1304118	hsa-miR-4696	CLIP-seq
MIRT1304119	hsa-miR-4733-3p	CLIP-seq
MIRT1304120	hsa-miR-4793-5p	CLIP-seq
MIRT1304121	hsa-miR-485-5p	CLIP-seq
MIRT1304122	hsa-miR-539	CLIP-seq
MIRT1304123	hsa-miR-580	CLIP-seq
MIRT1304124	hsa-miR-608	CLIP-seq
MIRT1304125	hsa-miR-650	CLIP-seq
MIRT1304126	hsa-miR-759	CLIP-seq
MIRT2314892	hsa-miR-3690	CLIP-seq
MIRT2314893	hsa-miR-4254	CLIP-seq
MIRT2314894	hsa-miR-4310	CLIP-seq
MIRT1304120	hsa-miR-4793-5p	CLIP-seq
MIRT2314895	hsa-miR-626	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000794	Component	Condensed nuclear chromosome	TAS	10869340
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS	9651375
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IBA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	TAS	9651375
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016363	Component	Nuclear matrix	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0030695	Function	GTPase regulator activity	IDA	9651375
GO:0030695	Function	GTPase regulator activity	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045202	Component	Synapse	IEA
GO:0045202	Component	Synapse	ISS

Other IDs

• MIM: 602512
• HGNC: 9994
• e!Ensembl: ENSG00000159788

Protein

• UniProt ID: O14924
• Protein name: Regulator of G-protein signaling 12 (RGS12)
• Protein function: Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. ; FUNCTI
• PDB: 2EBZ, 2KV8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00595	PDZ	22 → 96	PDZ domain	Domain
  PF00615	RGS	715 → 831	Regulator of G protein signaling domain	Domain
  PF16613	RGS12_us1	836 → 953		Disordered
  PF02196	RBD	963 → 1030	Raf-like Ras-binding domain	Domain
  PF02196	RBD	1034 → 1102	Raf-like Ras-binding domain	Domain
  PF16611	RGS12_us2	1106 → 1180		Disordered
  PF02188	GoLoco	1188 → 1209	GoLoco motif	Motif
  PF16612	RGS12_usC	1239 → 1376		Disordered

• Tissue specificity: TISSUE SPECIFICITY: Isoform 3 is brain specific.
• Sequence:

  MFRAGEASKRPLPGPSPPRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRA
  GDQILAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGVGRFESCSSDEEGGLYEGKGWL
  KPKLDSKALGINRAERVVEEMQSGGIFNMIFENPSLCASNSEPLKLKQRSLSESAATRFD
  VGHESINNPNPNMLSKEEISKVIHDDSVFSIGLESHDDFALDASILNVAMIVGYLGSIEL
  PSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDCVQLSTDKAGVVAEYPAEKLA
  FSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVFMVDPDLFNHKIHQGIARRFG
  FECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSS
  NSDSGIGNFHQEEKSNRVLVVDLGGSSSRHGPGGSAWDGVGGRGAQPWGAPWTGPFCPDP
  EGSPPFEAAHQTDRFWDLNKHLGPASPVEVPPASLRSSVPPSKRGTVGAGCGFNQRWLPV
  HVLREWQCGHTSDQDSYTDSTDGWSSINCGTLPPPMSKIPADRYRVEGSFAQPPLNAPKR
  EWSRKAFGMQSIFGPHRNVRKTKEDKKGSKFGRGTGLTQPSQRTSARRSFGRSKRFSITR
  SLDDLESATVSDGELTGADLKDCVSNNSLSSNASLPSVQSCRRLRERRVASWAVSFERLL
  QDPVGVRYFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATT
  PVNIDSQAQLADDVLRAPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRA
  LPDSQQVPSSPASKHSLGSDHSSVSTPKKLSGKSKSGRSLNEELGDEDSEKKRKGAFFSW
  SRTRSTGRSQKKREHGDHADDALHANGGLCRRESQGSVSSAGSLDLSEACRTLAPEKDKA
  TKHCCIHLPDGTSCVVAVKAGFSIKDILSGLCERHGINGAAADLFLVGGDKPLVLHQDSS
  ILESRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVARYGLDLSGLLVRLSG
  EKEPLDLGAPISSLDGQRVVLEEKDPSRGKASADKQKGVPVKQNTAVNSSSRNHSATGEE
  RTLGKSNSIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEEFFELISKAQSN
  RADDQRGLLRKEDLVLPEFLRLPPGSTELTLPTPAAVAKGFSKRSATGNGRESASQPGEQ
  WEPVQESSDSPSTSPGSASSPPGPPGTTPPGQKSPSGPFCTPQSPVSLAQEGTAQIWKRQ
  SQEVEAGGIQTVEDEHVAELTLMGEGDISSPNSTLLPPPSTPQEVPGPSRPGSGTHGSRD
  LPVNRIIDVDLVTGSAPGRDGGIAGAQAGPGRSQASGGPPTSDLPGLGPVPGEPAKPKTS
  AHHATFV

• Sequence length: 1447

Pathways

Reactome:

G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	25848939	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	32066727, 39518985	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	30489658		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28798985	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35068348	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21209843	Associate	★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Breast fibrocystic disease	Pubtator	28798985	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	35748249	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	GWASDB_DG	22387017		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28611045		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	31408461		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	GWASDB_DG	21211798		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	12461749, 28611045		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	31490121		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28611045		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25848939		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	CTD_human_DG	21822266		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	25420024	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	34034702	Associate	★☆☆☆☆ Found in Text Mining only