RGS10 (regulator of G protein signaling 10)

Gene

• Entrez ID: 6001
• Gene name: Regulator of G protein signaling 10
• Gene symbol: RGS10
• Synonyms (NCBI Gene): -
• Chromosome: 10
• Chromosome location: 10q26.11
• Summary: Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alph

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1304072	hsa-miR-1200	CLIP-seq
MIRT1304073	hsa-miR-3121-5p	CLIP-seq
MIRT1304074	hsa-miR-3125	CLIP-seq
MIRT1304075	hsa-miR-3916	CLIP-seq
MIRT1304076	hsa-miR-3977	CLIP-seq
MIRT1304077	hsa-miR-4324	CLIP-seq
MIRT1304078	hsa-miR-544b	CLIP-seq
MIRT1304072	hsa-miR-1200	CLIP-seq
MIRT1304074	hsa-miR-3125	CLIP-seq
MIRT1304075	hsa-miR-3916	CLIP-seq
MIRT1304077	hsa-miR-4324	CLIP-seq
MIRT1304078	hsa-miR-544b	CLIP-seq
MIRT2090121	hsa-miR-564	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
DNMT1	Unknown	24475290
HDAC1	Unknown	24475290

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001965	Function	G-protein alpha-subunit binding	IEA
GO:0001965	Function	G-protein alpha-subunit binding	IPI	18434541
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005096	Function	GTPase activator activity	IDA	11443111, 18434541
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IDA	10791963, 11443111
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	11443111
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007213	Process	G protein-coupled acetylcholine receptor signaling pathway	IDA	11443111
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0043547	Process	Positive regulation of GTPase activity	IDA	18434541
GO:0045202	Component	Synapse	IEA

Other IDs

• MIM: 602856
• HGNC: 9992
• e!Ensembl: ENSG00000148908

Protein

• UniProt ID: O43665
• Protein name: Regulator of G-protein signaling 10 (RGS10)
• Protein function: Regulates G protein-coupled receptor signaling cascades, including signaling downstream of the muscarinic acetylcholine receptor CHRM2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving t
• PDB: 2DLR, 2I59, 2IHB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00615	RGS	41 → 155	Regulator of G protein signaling domain	Domain

• Sequence:

  MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLK
  KEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILE
  EPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYN
  T

• Sequence length: 181

Pathways

Reactome:

G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANTIPHOSPHOLIPID SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EDEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Age related macular degeneration	Age-related macular degeneration	BEFREE	16080115, 25784210		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	26902301	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	17626792		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26516143	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23533674, 24475290		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31578828		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	31578828	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism Pituitary	Pituitary dwarfism	Pubtator	34315806	Associate	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	34315806	Associate	★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	Pubtator	34315806	Associate	★☆☆☆☆ Found in Text Mining only
Infantile malignant osteopetrosis	Malignant Osteopetrosis	BEFREE	17626792		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	16080115	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23533674, 24475290		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30049816		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31578828		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	26902301	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24475290		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	26902301	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	21849548, 25784210		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23533674, 24475290		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21044322, 23533674, 24475290, 26319900, 33845140	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	21849548		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26902301	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15482592, 31578828		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	31578828	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	33387485	Associate	★☆☆☆☆ Found in Text Mining only