RGS7 (regulator of G protein signaling 7)

Gene

• Entrez ID: 6000
• Gene name: Regulator of G protein signaling 7
• Gene symbol: RGS7
• Synonyms (NCBI Gene): -
• Chromosome: 1
• Chromosome location: 1q43|1q23.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1304542	hsa-miR-1	CLIP-seq
MIRT1304543	hsa-miR-206	CLIP-seq
MIRT1304544	hsa-miR-3166	CLIP-seq
MIRT1304545	hsa-miR-329	CLIP-seq
MIRT1304546	hsa-miR-362-3p	CLIP-seq
MIRT1304547	hsa-miR-3673	CLIP-seq
MIRT1304548	hsa-miR-3941	CLIP-seq
MIRT1304549	hsa-miR-4277	CLIP-seq
MIRT1304550	hsa-miR-4428	CLIP-seq
MIRT1304551	hsa-miR-4709-5p	CLIP-seq
MIRT1304552	hsa-miR-544	CLIP-seq
MIRT1304553	hsa-miR-582-5p	CLIP-seq
MIRT1304554	hsa-miR-603	CLIP-seq
MIRT1304555	hsa-miR-610	CLIP-seq
MIRT1304556	hsa-miR-613	CLIP-seq
MIRT2090232	hsa-miR-145	CLIP-seq
MIRT2090233	hsa-miR-3136-5p	CLIP-seq
MIRT2090234	hsa-miR-4328	CLIP-seq
MIRT2090235	hsa-miR-4439	CLIP-seq
MIRT2090236	hsa-miR-4513	CLIP-seq
MIRT2090237	hsa-miR-943	CLIP-seq
MIRT2090232	hsa-miR-145	CLIP-seq
MIRT2090233	hsa-miR-3136-5p	CLIP-seq
MIRT2090234	hsa-miR-4328	CLIP-seq
MIRT2090235	hsa-miR-4439	CLIP-seq
MIRT2090236	hsa-miR-4513	CLIP-seq
MIRT2090237	hsa-miR-943	CLIP-seq
MIRT2393691	hsa-miR-127-5p	CLIP-seq
MIRT2393692	hsa-miR-4711-3p	CLIP-seq
MIRT2458159	hsa-miR-3909	CLIP-seq
MIRT2458160	hsa-miR-767-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001965	Function	G-protein alpha-subunit binding	IDA	36996198
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IDA	10521509, 31189666, 36996198
GO:0005096	Function	GTPase activator activity	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	10521509
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	10521509
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	31189666
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IEA
GO:0031681	Function	G-protein beta-subunit binding	IPI	19376773
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043547	Process	Positive regulation of GTPase activity	IDA	10521509
GO:0044292	Component	Dendrite terminus	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	IDA	36996198
GO:0051286	Component	Cell tip	IEA
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA

Other IDs

• MIM: 602517
• HGNC: 10003
• e!Ensembl: ENSG00000182901

Protein

• UniProt ID: P49802
• Protein name: Regulator of G-protein signaling 7 (RGS7)
• Protein function: GTPase activator component of the RGS7-GNB5 complex that regulates G protein-coupled receptor signaling cascades (PubMed:10521509, PubMed:10862767, PubMed:31189666). The RGS7-GNB5 complex acts as an inhibitor signal transduction by promoting the
• PDB: 2A72, 2D9J, 7EWP, 7EWR, 7SHF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00610	DEP	40 → 110	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)	Domain
  PF18148	RGS_DHEX	113 → 214	Regulator of G-protein signalling DHEX domain	Domain
  PF00631	G-gamma	252 → 316	GGL domain	Domain
  PF00615	RGS	333 → 447	Regulator of G protein signaling domain	Domain

• Sequence:

  MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGS
  DIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNC
  WEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKK
  RDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSH
  SPTHTPTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYLEYDPFLLPP
  DPSNPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENL
  RFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFE
  DAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKKSGNSMDRRTSFEKFAQNVGRNIPIFPC
  HKNCTPTLRASTNLL

• Sequence length: 495

Pathways

Reactome:

G alpha (i) signalling events
Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARDIAC EMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOEMBOLIC STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL ANOMALY OF ESOPHAGUS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOID LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL RETARDATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROPHARYNX CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEONECROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	29531354		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27533483		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27533483		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37761960	Associate	★☆☆☆☆ Found in Text Mining only
Cardioembolic stroke	Cardioembolic Stroke	GWASCAT_DG	29531354		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Ischemic stroke	Pubtator	27533483	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27533483		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	CTD_human_DG	29531354		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognition disorder	Pubtator	25712083	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30546127		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	25102180		★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	39662927	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	CTD_human_DG	21937992		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ischemic stroke	Ischemic Stroke	BEFREE	27533483		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30540250		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29330521		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	29330521	Associate	★☆☆☆☆ Found in Text Mining only
Mental deficiency	Mental retardation	CTD_human_DG	21937992		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30546127		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23555580, 29330521		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	36999276	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	18762858		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	10339594	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	10339594		★☆☆☆☆ Found in Text Mining only
Profound Mental Retardation	Mental retardation	CTD_human_DG	21937992		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37308506	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	26113603		★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	37308506	Associate	★☆☆☆☆ Found in Text Mining only