Gene Gene information from NCBI Gene database.
Entrez ID 5999
Gene name Regulator of G protein signaling 4
Gene symbol RGS4
Synonyms (NCBI Gene)
RGP4SCZD9
Chromosome 1
Chromosome location 1q23.3
Summary Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alph
miRNA miRNA information provided by mirtarbase database.
263
miRTarBase ID miRNA Experiments Reference
MIRT054900 hsa-miR-124-3p Luciferase reporter assay 23332465
MIRT054900 hsa-miR-124-3p Luciferase reporter assay 23332465
MIRT549834 hsa-miR-223-5p HITS-CLIP 21572407
MIRT549833 hsa-miR-6867-5p HITS-CLIP 21572407
MIRT549832 hsa-miR-574-5p HITS-CLIP 21572407
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
NFKB1 Activation 18260825
PROX1 Repression 22942256
RELA Activation 18260825
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
28
GO ID Ontology Definition Evidence Reference
GO:0001965 Function G-protein alpha-subunit binding IEA
GO:0001975 Process Response to amphetamine IEA
GO:0003924 Function GTPase activity IEA
GO:0003924 Function GTPase activity TAS
GO:0005096 Function GTPase activator activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602516 10000 ENSG00000117152
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P49798
Protein name Regulator of G-protein signaling 4 (RGP4) (RGS4)
Protein function Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Activity on G(z)-alpha is inhibited by phosphorylation of the G-protein. Activity on G(z)-alpha a
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00615 RGS 62 177 Regulator of G protein signaling domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in brain and heart. Expressed in brain at protein level. Expressed in prefontal and visual cortex. Isoform 4 and isoform 5 are expressed ubiquitously. Isoform 1, isoform 2 and isoform 3 are not expressed in the cerebellum. {E
Sequence
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDL
VNP
SSCGAEKQKGAKSSADCASLVPQCA
Sequence length 205
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    G alpha (q) signalling events
G alpha (i) signalling events
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
9
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARDIAC EMBOLISM GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARDIOEMBOLIC STROKE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 34668150 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Asthma Asthma Pubtator 22253691 Associate
★☆☆☆☆
Found in Text Mining only
Asthma Asthma BEFREE 28853915, 30022363
★☆☆☆☆
Found in Text Mining only
Astrocytoma Astrocytoma BEFREE 26263491
★☆☆☆☆
Found in Text Mining only
Atrial Fibrillation Atrial fibrillation Pubtator 37960721 Associate
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorder Autism Pubtator 39519104 Associate
★☆☆☆☆
Found in Text Mining only
Bipolar Disorder Bipolar Disorder BEFREE 15660667, 17410640, 18685145, 20414142
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Bipolar Disorder Bipolar Disorder LHGDN 15660667
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Bipolar Disorder Bipolar disorder Pubtator 15660667 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Bipolar Disorder Bipolar Disorder PSYGENET_DG 17106420, 17239488, 17410640, 18685145, 20414142
★★☆☆☆
Found in Text Mining + Unknown/Other Associations