Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5999
Gene name	Regulator of G protein signaling 4
Gene symbol	RGS4
Synonyms (NCBI Gene)	RGP4SCZD9
Chromosome	1
Chromosome location	1q23.3
Summary	Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alph

263

Show/Hide all (263)

miRTarBase ID	miRNA	Experiments	Reference
MIRT054900	hsa-miR-124-3p	Luciferase reporter assay	23332465
MIRT054900	hsa-miR-124-3p	Luciferase reporter assay	23332465
MIRT549834	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT549833	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT549832	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT683473	hsa-miR-342-3p	HITS-CLIP	23313552
MIRT549834	hsa-miR-223-5p	HITS-CLIP	23313552
MIRT549833	hsa-miR-6867-5p	HITS-CLIP	23313552
MIRT549832	hsa-miR-574-5p	HITS-CLIP	23313552
MIRT549834	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT549833	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT549832	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT549834	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT549833	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT549832	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT576239	hsa-miR-342-3p	HITS-CLIP	23313552
MIRT549834	hsa-miR-223-5p	HITS-CLIP	23313552
MIRT549833	hsa-miR-6867-5p	HITS-CLIP	23313552
MIRT549832	hsa-miR-574-5p	HITS-CLIP	23313552
MIRT549834	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT549833	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT549832	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT1304408	hsa-miR-1266	CLIP-seq
MIRT1304409	hsa-miR-3148	CLIP-seq
MIRT1304410	hsa-miR-3664-3p	CLIP-seq
MIRT1304411	hsa-miR-377	CLIP-seq
MIRT1304412	hsa-miR-4420	CLIP-seq
MIRT1304413	hsa-miR-4502	CLIP-seq
MIRT1304414	hsa-miR-4518	CLIP-seq
MIRT1304415	hsa-miR-671-5p	CLIP-seq
MIRT1304416	hsa-miR-873	CLIP-seq
MIRT1304417	hsa-miR-18a	CLIP-seq
MIRT1304418	hsa-miR-18b	CLIP-seq
MIRT1304419	hsa-miR-198	CLIP-seq
MIRT1304420	hsa-miR-3691-5p	CLIP-seq
MIRT1304421	hsa-miR-380	CLIP-seq
MIRT1304422	hsa-miR-3907	CLIP-seq
MIRT1304423	hsa-miR-4270	CLIP-seq
MIRT1304424	hsa-miR-4441	CLIP-seq
MIRT1304425	hsa-miR-4468	CLIP-seq
MIRT1304426	hsa-miR-4491	CLIP-seq
MIRT1304427	hsa-miR-4657	CLIP-seq
MIRT1304428	hsa-miR-4685-5p	CLIP-seq
MIRT1304429	hsa-miR-4690-5p	CLIP-seq
MIRT1304430	hsa-miR-4735-3p	CLIP-seq
MIRT1304431	hsa-miR-4752	CLIP-seq
MIRT1304432	hsa-miR-4778-5p	CLIP-seq
MIRT1304433	hsa-miR-630	CLIP-seq
MIRT1304434	hsa-miR-1224-3p	CLIP-seq
MIRT1304435	hsa-miR-1260	CLIP-seq
MIRT1304436	hsa-miR-1260b	CLIP-seq
MIRT1304408	hsa-miR-1266	CLIP-seq
MIRT1304437	hsa-miR-1280	CLIP-seq
MIRT1304409	hsa-miR-3148	CLIP-seq
MIRT1304438	hsa-miR-3620	CLIP-seq
MIRT1304410	hsa-miR-3664-3p	CLIP-seq
MIRT1304439	hsa-miR-371-5p	CLIP-seq
MIRT1304411	hsa-miR-377	CLIP-seq
MIRT1304413	hsa-miR-4502	CLIP-seq
MIRT1304414	hsa-miR-4518	CLIP-seq
MIRT1304416	hsa-miR-873	CLIP-seq
MIRT1304440	hsa-miR-888	CLIP-seq
MIRT1304411	hsa-miR-377	CLIP-seq
MIRT1556989	hsa-miR-374c	CLIP-seq
MIRT1556990	hsa-miR-655	CLIP-seq
MIRT1304411	hsa-miR-377	CLIP-seq
MIRT2314933	hsa-miR-3180-5p	CLIP-seq
MIRT1304420	hsa-miR-3691-5p	CLIP-seq
MIRT1304426	hsa-miR-4491	CLIP-seq
MIRT1304427	hsa-miR-4657	CLIP-seq
MIRT1304431	hsa-miR-4752	CLIP-seq
MIRT2314934	hsa-miR-4757-5p	CLIP-seq
MIRT2314935	hsa-miR-4789-3p	CLIP-seq
MIRT2314936	hsa-miR-4789-5p	CLIP-seq
MIRT2393690	hsa-miR-103a	CLIP-seq
MIRT1304420	hsa-miR-3691-5p	CLIP-seq
MIRT1304411	hsa-miR-377	CLIP-seq
MIRT1304426	hsa-miR-4491	CLIP-seq
MIRT1304427	hsa-miR-4657	CLIP-seq
MIRT1304431	hsa-miR-4752	CLIP-seq
MIRT2393690	hsa-miR-103a	CLIP-seq
MIRT1304411	hsa-miR-377	CLIP-seq
MIRT2393690	hsa-miR-103a	CLIP-seq
MIRT1304411	hsa-miR-377	CLIP-seq
MIRT2393690	hsa-miR-103a	CLIP-seq
MIRT2611258	hsa-miR-103b	CLIP-seq
MIRT2611259	hsa-miR-1202	CLIP-seq
MIRT2611260	hsa-miR-1256	CLIP-seq
MIRT2611261	hsa-miR-1301	CLIP-seq
MIRT2611262	hsa-miR-142-5p	CLIP-seq
MIRT2611263	hsa-miR-297	CLIP-seq
MIRT2611264	hsa-miR-31	CLIP-seq
MIRT2611265	hsa-miR-3117-5p	CLIP-seq
MIRT2611266	hsa-miR-3149	CLIP-seq
MIRT2611267	hsa-miR-3154	CLIP-seq
MIRT2314933	hsa-miR-3180-5p	CLIP-seq
MIRT2611268	hsa-miR-3190	CLIP-seq
MIRT2611269	hsa-miR-329	CLIP-seq
MIRT2611270	hsa-miR-3607-5p	CLIP-seq
MIRT2611271	hsa-miR-3616-5p	CLIP-seq
MIRT2611272	hsa-miR-362-3p	CLIP-seq
MIRT2611273	hsa-miR-3647-5p	CLIP-seq
MIRT1304420	hsa-miR-3691-5p	CLIP-seq
MIRT2611274	hsa-miR-369-3p	CLIP-seq
MIRT2611275	hsa-miR-374a	CLIP-seq
MIRT2611276	hsa-miR-374b	CLIP-seq
MIRT1556989	hsa-miR-374c	CLIP-seq
MIRT2611277	hsa-miR-376c	CLIP-seq
MIRT1304411	hsa-miR-377	CLIP-seq
MIRT2611278	hsa-miR-3915	CLIP-seq
MIRT2611279	hsa-miR-3924	CLIP-seq
MIRT2611280	hsa-miR-3926	CLIP-seq
MIRT2611281	hsa-miR-3928	CLIP-seq
MIRT2611282	hsa-miR-3941	CLIP-seq
MIRT2611283	hsa-miR-3972	CLIP-seq
MIRT2611284	hsa-miR-410	CLIP-seq
MIRT2611285	hsa-miR-4297	CLIP-seq
MIRT2611286	hsa-miR-4299	CLIP-seq
MIRT2611287	hsa-miR-4434	CLIP-seq
MIRT2611288	hsa-miR-4436b-3p	CLIP-seq
MIRT2611289	hsa-miR-4456	CLIP-seq
MIRT2611290	hsa-miR-4477a	CLIP-seq
MIRT1304426	hsa-miR-4491	CLIP-seq
MIRT2611291	hsa-miR-4501	CLIP-seq
MIRT1304413	hsa-miR-4502	CLIP-seq
MIRT2611292	hsa-miR-4504	CLIP-seq
MIRT2611293	hsa-miR-450b-5p	CLIP-seq
MIRT2611294	hsa-miR-4516	CLIP-seq
MIRT2611295	hsa-miR-4531	CLIP-seq
MIRT2611296	hsa-miR-4633-3p	CLIP-seq
MIRT2611297	hsa-miR-4642	CLIP-seq
MIRT1304427	hsa-miR-4657	CLIP-seq
MIRT2611298	hsa-miR-466	CLIP-seq
MIRT2611299	hsa-miR-4666-5p	CLIP-seq
MIRT2611300	hsa-miR-4672	CLIP-seq
MIRT1304428	hsa-miR-4685-5p	CLIP-seq
MIRT2611301	hsa-miR-4690-3p	CLIP-seq
MIRT2611302	hsa-miR-4696	CLIP-seq
MIRT2611303	hsa-miR-4711-3p	CLIP-seq
MIRT2611304	hsa-miR-4714-3p	CLIP-seq
MIRT2611305	hsa-miR-4731-3p	CLIP-seq
MIRT1304431	hsa-miR-4752	CLIP-seq
MIRT2314934	hsa-miR-4757-5p	CLIP-seq
MIRT2611306	hsa-miR-4761-3p	CLIP-seq
MIRT2611307	hsa-miR-4764-5p	CLIP-seq
MIRT2314935	hsa-miR-4789-3p	CLIP-seq
MIRT2314936	hsa-miR-4789-5p	CLIP-seq
MIRT2611308	hsa-miR-4801	CLIP-seq
MIRT2611309	hsa-miR-487a	CLIP-seq
MIRT2611310	hsa-miR-5047	CLIP-seq
MIRT2611311	hsa-miR-507	CLIP-seq
MIRT2611312	hsa-miR-508-5p	CLIP-seq
MIRT2611313	hsa-miR-516b	CLIP-seq
MIRT2611314	hsa-miR-518d-5p	CLIP-seq
MIRT2611315	hsa-miR-519b-5p	CLIP-seq
MIRT2611316	hsa-miR-519c-5p	CLIP-seq
MIRT2611317	hsa-miR-520a-5p	CLIP-seq
MIRT2611318	hsa-miR-520c-5p	CLIP-seq
MIRT2611319	hsa-miR-525-5p	CLIP-seq
MIRT2611320	hsa-miR-526a	CLIP-seq
MIRT2611321	hsa-miR-542-3p	CLIP-seq
MIRT2611322	hsa-miR-548q	CLIP-seq
MIRT2611323	hsa-miR-548s	CLIP-seq
MIRT2611324	hsa-miR-557	CLIP-seq
MIRT2611325	hsa-miR-561	CLIP-seq
MIRT2611326	hsa-miR-573	CLIP-seq
MIRT2611327	hsa-miR-579	CLIP-seq
MIRT2611328	hsa-miR-586	CLIP-seq
MIRT2611329	hsa-miR-603	CLIP-seq
MIRT2611330	hsa-miR-642a	CLIP-seq
MIRT1556990	hsa-miR-655	CLIP-seq
MIRT2611331	hsa-miR-892a	CLIP-seq
MIRT2611332	hsa-miR-924	CLIP-seq
MIRT2393690	hsa-miR-103a	CLIP-seq
MIRT2611258	hsa-miR-103b	CLIP-seq
MIRT2611259	hsa-miR-1202	CLIP-seq
MIRT2611260	hsa-miR-1256	CLIP-seq
MIRT2611261	hsa-miR-1301	CLIP-seq
MIRT2611262	hsa-miR-142-5p	CLIP-seq
MIRT2611263	hsa-miR-297	CLIP-seq
MIRT2611264	hsa-miR-31	CLIP-seq
MIRT2611265	hsa-miR-3117-5p	CLIP-seq
MIRT2611266	hsa-miR-3149	CLIP-seq
MIRT2611267	hsa-miR-3154	CLIP-seq
MIRT2314933	hsa-miR-3180-5p	CLIP-seq
MIRT2611268	hsa-miR-3190	CLIP-seq
MIRT2611269	hsa-miR-329	CLIP-seq
MIRT2611270	hsa-miR-3607-5p	CLIP-seq
MIRT2611271	hsa-miR-3616-5p	CLIP-seq
MIRT2611272	hsa-miR-362-3p	CLIP-seq
MIRT2611273	hsa-miR-3647-5p	CLIP-seq
MIRT1304420	hsa-miR-3691-5p	CLIP-seq
MIRT2611274	hsa-miR-369-3p	CLIP-seq
MIRT2611275	hsa-miR-374a	CLIP-seq
MIRT2611276	hsa-miR-374b	CLIP-seq
MIRT1556989	hsa-miR-374c	CLIP-seq
MIRT2611277	hsa-miR-376c	CLIP-seq
MIRT1304411	hsa-miR-377	CLIP-seq
MIRT2611278	hsa-miR-3915	CLIP-seq
MIRT2611279	hsa-miR-3924	CLIP-seq
MIRT2611280	hsa-miR-3926	CLIP-seq
MIRT2611281	hsa-miR-3928	CLIP-seq
MIRT2611282	hsa-miR-3941	CLIP-seq
MIRT2611283	hsa-miR-3972	CLIP-seq
MIRT2611284	hsa-miR-410	CLIP-seq
MIRT2611286	hsa-miR-4299	CLIP-seq
MIRT2611287	hsa-miR-4434	CLIP-seq
MIRT2611288	hsa-miR-4436b-3p	CLIP-seq
MIRT2611289	hsa-miR-4456	CLIP-seq
MIRT2611290	hsa-miR-4477a	CLIP-seq
MIRT1304426	hsa-miR-4491	CLIP-seq
MIRT2611291	hsa-miR-4501	CLIP-seq
MIRT1304413	hsa-miR-4502	CLIP-seq
MIRT2611292	hsa-miR-4504	CLIP-seq
MIRT2611293	hsa-miR-450b-5p	CLIP-seq
MIRT2611294	hsa-miR-4516	CLIP-seq
MIRT2611295	hsa-miR-4531	CLIP-seq
MIRT2611296	hsa-miR-4633-3p	CLIP-seq
MIRT2611297	hsa-miR-4642	CLIP-seq
MIRT1304427	hsa-miR-4657	CLIP-seq
MIRT2611298	hsa-miR-466	CLIP-seq
MIRT2611299	hsa-miR-4666-5p	CLIP-seq
MIRT2611300	hsa-miR-4672	CLIP-seq
MIRT1304428	hsa-miR-4685-5p	CLIP-seq
MIRT2611302	hsa-miR-4696	CLIP-seq
MIRT2611303	hsa-miR-4711-3p	CLIP-seq
MIRT2611304	hsa-miR-4714-3p	CLIP-seq
MIRT2611305	hsa-miR-4731-3p	CLIP-seq
MIRT1304431	hsa-miR-4752	CLIP-seq
MIRT2314934	hsa-miR-4757-5p	CLIP-seq
MIRT2611306	hsa-miR-4761-3p	CLIP-seq
MIRT2611307	hsa-miR-4764-5p	CLIP-seq
MIRT2314935	hsa-miR-4789-3p	CLIP-seq
MIRT2314936	hsa-miR-4789-5p	CLIP-seq
MIRT2611308	hsa-miR-4801	CLIP-seq
MIRT2611309	hsa-miR-487a	CLIP-seq
MIRT2611310	hsa-miR-5047	CLIP-seq
MIRT2611311	hsa-miR-507	CLIP-seq
MIRT2611312	hsa-miR-508-5p	CLIP-seq
MIRT2611313	hsa-miR-516b	CLIP-seq
MIRT2611314	hsa-miR-518d-5p	CLIP-seq
MIRT2611315	hsa-miR-519b-5p	CLIP-seq
MIRT2611316	hsa-miR-519c-5p	CLIP-seq
MIRT2611317	hsa-miR-520a-5p	CLIP-seq
MIRT2611318	hsa-miR-520c-5p	CLIP-seq
MIRT2611319	hsa-miR-525-5p	CLIP-seq
MIRT2611320	hsa-miR-526a	CLIP-seq
MIRT2611321	hsa-miR-542-3p	CLIP-seq
MIRT2611322	hsa-miR-548q	CLIP-seq
MIRT2611323	hsa-miR-548s	CLIP-seq
MIRT2611324	hsa-miR-557	CLIP-seq
MIRT2611325	hsa-miR-561	CLIP-seq
MIRT2611326	hsa-miR-573	CLIP-seq
MIRT2611327	hsa-miR-579	CLIP-seq
MIRT2611328	hsa-miR-586	CLIP-seq
MIRT2611329	hsa-miR-603	CLIP-seq
MIRT2611330	hsa-miR-642a	CLIP-seq
MIRT1556990	hsa-miR-655	CLIP-seq
MIRT2611332	hsa-miR-924	CLIP-seq
MIRT2611264	hsa-miR-31	CLIP-seq
MIRT1556989	hsa-miR-374c	CLIP-seq
MIRT2611303	hsa-miR-4711-3p	CLIP-seq
MIRT1556990	hsa-miR-655	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
NFKB1	Activation	18260825
PROX1	Repression	22942256
RELA	Activation	18260825

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001965	Function	G-protein alpha-subunit binding	IEA
GO:0001975	Process	Response to amphetamine	IEA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS	10747990
GO:0005516	Function	Calmodulin binding	TAS	10747990
GO:0005634	Component	Nucleus	IDA	10791963
GO:0005737	Component	Cytoplasm	IDA	10791963
GO:0005886	Component	Plasma membrane	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	TAS	10747990
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0010460	Process	Positive regulation of heart rate	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	IEA
GO:0051924	Process	Regulation of calcium ion transport	IEA
GO:0060160	Process	Negative regulation of dopamine receptor signaling pathway	IEA
GO:0061052	Process	Negative regulation of cell growth involved in cardiac muscle cell development	IEA
GO:0110053	Process	Regulation of actin filament organization	IEA
GO:1900924	Process	Negative regulation of glycine import across plasma membrane	IEA
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IEA
GO:1901380	Process	Negative regulation of potassium ion transmembrane transport	IEA
GO:1990791	Process	Dorsal root ganglion development	IEA
GO:2000463	Process	Positive regulation of excitatory postsynaptic potential	IEA

MIM	HGNC	e!Ensembl
602516	10000	ENSG00000117152

P49798

Protein name

Regulator of G-protein signaling 4 (RGP4) (RGS4)

Protein function

Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Activity on G(z)-alpha is inhibited by phosphorylation of the G-protein. Activity on G(z)-alpha a

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00615	RGS	62 → 177	Regulator of G protein signaling domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain and heart. Expressed in brain at protein level. Expressed in prefontal and visual cortex. Isoform 4 and isoform 5 are expressed ubiquitously. Isoform 1, isoform 2 and isoform 3 are not expressed in the cerebellum. {E

Sequence

MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNP
SSCGAEKQKGAKSSADCASLVPQCA

Sequence length

205

Interactions

View interactions

	Reactome
			G alpha (q) signalling events G alpha (i) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC EMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOEMBOLIC STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (58)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	34668150	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	22253691	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28853915, 30022363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	26263491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	37960721	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	39519104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	15660667, 17410640, 18685145, 20414142		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	15660667		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	15660667	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	17106420, 17239488, 17410640, 18685145, 20414142		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	17106420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23529717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19549919, 22799288, 28588709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20946665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23529717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21859834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	12176127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36466094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	20864642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	20864642		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	Pubtator	24041654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28697377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21859834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	21215802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32392739, 32510239, 32634050, 39938577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15055445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	12176127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31612026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	11326297, 18434012, 29563799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19549919, 22799288, 28588709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	18575725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23529717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28588709, 29131258		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29108247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	17301167, 28544755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	34748583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29131258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	29131258		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28697377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10936173, 19416973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31695428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	17301167, 26910404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29955167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	36309699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17971902, 33845140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31587286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	24041654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28697377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	16380905, 17301167	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	17301167, 26803614, 26910404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	36050939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11326297, 12023979, 14732600, 14755443, 15182322, 15274033, 15381923, 15660667, 15744031, 16082709, 16176390, 16469939, 16508931, 16526029, 16604300 View all (31 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	12436019, 14732600, 15274033, 16508931, 16526029, 16860780, 16904822, 17515439, 17588543, 17722013, 18204343, 18622782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	16380905, 17301167, 17410640, 19282471, 34871224, 39202417	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	18575725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	18575725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	11326297, 18434012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23529717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RGS4 (regulator of G protein signaling 4)